(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Gammaproteobacteria: NE > Legionellales: NE > Legionellaceae: NE > Legionella: NE > Legionella pneumophila: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Legionella pneumophila str. Paris: N, E.
Legionella pneumophila subsp. pneumophila: N, E.
Legionella pneumophila subsp. pneumophila str. Philadelphia 1: N, E.
Legionella pneumophila str. Lens: N, E.
Legionella pneumophila str. Corby: N, E.
Legionella pneumophila 2300/99 Alcoy: N, E.
Legionella pneumophila 130b: N, E.
Legionella pneumophila serogroup 1: N, E.
Legionella pneumophila str. Leg01/11: N, E.
Legionella pneumophila str. Leg01/53: N, E.
Legionella pneumophila str. Leg01/20: N, E.
Legionella pneumophila subsp. pneumophila ATCC 43290: N, E.
Legionella pneumophila subsp. pneumophila str. Thunder Bay: N, E.
Legionella pneumophila subsp. pneumophila LPE509: N, E.
Legionella pneumophila str. 121004: N, E.
Legionella hackeliae: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA TIKFYDKDRKRFIPVKMYVSNESQGKANAGILKLPVAIINHGYTVRNTEY SFLANALAGNGYFVVSIQHDLKSDPPLAQTGNLFEQRKPLWERGSANIRY VIKELNRINPSLNLSKVTLIGHSNGGDIAMLFASKYPQLVEKIISLDSLR MPFPRTGLTPILSLRGNDTKADEGVLPPKESLKQLAITIIPLPEVKHIDL CDRSSKVTQQQINDLILKFLRG
Legionella pneumophila, the causative agent of Legionnaires' disease, replicates as an intracellular parasite of amoebae and persists in the environment as a free-living microbe. Here we have analyzed the complete genome sequences of L. pneumophila Paris (3,503,610 bp, 3,077 genes), an endemic strain that is predominant in France, and Lens (3,345,687 bp, 2,932 genes), an epidemic strain responsible for a major outbreak of disease in France. The L. pneumophila genomes show marked plasticity, with three different plasmids and with about 13% of the sequence differing between the two strains. Only strain Paris contains a type V secretion system, and its Lvh type IV secretion system is encoded by a 36-kb region that is either carried on a multicopy plasmid or integrated into the chromosome. Genetic mobility may enhance the versatility of L. pneumophila. Numerous genes encode eukaryotic-like proteins or motifs that are predicted to modulate host cell functions to the pathogen's advantage. The genome thus reflects the history and lifestyle of L. pneumophila, a human pathogen of macrophages that coevolved with fresh-water amoebae.
Legionella pneumophila Putative uncharacterized protein