Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: legpa-q5x473

Legionella pneumophila hypothetical protein

Comment
Other strains: Legionella pneumophila (strain Paris; Lens; subsp. pneumophila (strains Philadelphia 1; ATCC 43290; LPE509; Thunder Bay); Corby; serogroup 1 (strain 2300/99 Alcoy); 121004; Leg01/11; Leg01/20)


Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Legionella pneumophila
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Legionellales: N E > Legionellaceae: N E > Legionella: N E > Legionella pneumophila: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: legpa-q5x473
Colored MSA for Proline_iminopeptidase (raw)
MHTLYPAIKPYTQHELKVSKLHTLYLEETGNPEGIPVIVLHHGPGGEADP
HLRRFFDPQRYRIILFDQRGCGRSIPHLEISENNTQLLMEDIDSIRDFLG
LREFVLFGGGWGSLLALLYAQKFPQQVKALLLHQIFLGRQKDIDWFYKHG
ASLVYPDYWEEFTNTVPENKLDNIPKYYAECLQGSNELARMAAAKNWALW
QARCSSLQPHLYVIDQYSDPHFALALATLESYYIINHYFIEENQVIANAH
KIRHIPTYIVHGRFDLVSPLSSAWELHQAIPASNLRIVRDAGHSDRESGI
IDALIYASKDISKQGLDAC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHTLYPAIKPYTQHELKVSKLHTLYLEETGNPEGIPVIVLHHGPGGEADP
HLRRFFDPQRYRIILFDQRGCGRSIPHLEISENNTQLLMEDIDSIRDFLG
LREFVLFGGGWGSLLALLYAQKFPQQVKALLLHQIFLGRQKDIDWFYKHG
ASLVYPDYWEEFTNTVPENKLDNIPKYYAECLQGSNELARMAAAKNWALW
QARCSSLQPHLYVIDQYSDPHFALALATLESYYIINHYFIEENQVIANAH
KIRHIPTYIVHGRFDLVSPLSSAWELHQAIPASNLRIVRDAGHSDRESGI
IDALIYASKDISKQGLDAC


References
3 more
    Title: Comparative Genomics Reveal That Host-Innate Immune Responses Influence the Clinical Prevalence of Serogroups
    Khan MA, Knox N, Prashar A, Alexander D, Abdel-Nour M, Duncan C, Tang P, Amatullah H, Dos Santos CC and Guyard C <6 more author(s)>
    Ref: PLoS ONE, 8:e67298, 2013 : PubMed

            

    Title: Evidence in the Legionella pneumophila genome for exploitation of host cell functions and high genome plasticity
    Cazalet C, Rusniok C, Bruggemann H, Zidane N, Magnier A, Ma L, Tichit M, Jarraud S, Bouchier C and Buchrieser C <4 more author(s)>
    Ref: Nat Genet, 36:1165, 2004 : PubMed

            

    Title: The genomic sequence of the accidental pathogen Legionella pneumophila
    Chien M, Morozova I, Shi S, Sheng H, Chen J, Gomez SM, Asamani G, Hill K, Nuara J and Russo JJ <27 more author(s)>
    Ref: Science, 305:1966, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer