Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: leima-q4qj45

Leishmania major, Leishmania mexicana, L. donovani, L. amazonensis, L. braziliensis, L. infantum Oligopeptidase B-like protein Serine peptidase, clan sc, family s9a-like protein)

Comment
Other strains: Leishmania major, Leishmania mexicana (strain MHOM/GT/2001/U1103), Leishmania donovani (strain BPK282A1),Leishmania amazonensis, Leishmania braziliensis, Leishmania infantum


Relationship
Family|S9N_PREPL_Peptidase_S9
Block| X
Position in NCBI Life Tree|Leishmania major
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Euglenozoa: N E > Kinetoplastida: N E > Trypanosomatidae: N E > Leishmaniinae: N E > Leishmania [genus]: N E > Leishmania [subgenus]: N E > Leishmania major species complex: N E > Leishmania major: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: CT005245, FR799559, FR799593
>3 UniProt links 3 more: Q4QJ45, E9AKR2, E9B8P5
>3 UniProt links 3 more: Q4QJ45, E9AKR2, E9B8P5
>3 Interpro links 3 more: Q4QJ45, E9AKR2, E9B8P5
>3 Prodom links 3 more: Q4QJ45, E9AKR2, E9B8P5
>3 Pfam links 3 more: Q4QJ45, E9AKR2, E9B8P5
>3 PIRSF links 3 more: Q4QJ45, E9AKR2, E9B8P5
>3 SUPERFAM links 3 more: Q4QJ45, E9AKR2, E9B8P5
Sequence
Graphical view for this peptide sequence: leima-q4qj45
Colored MSA for S9N_PREPL_Peptidase_S9 (raw)
MAALFPWVPTSNLGYSLSRRAVNKWCPQLRTSYPLPMLDGPLPTEKPEGL
ELHGETQKPDPFRYMEDLFDRNTQEYTKKEMQHFSLISSKFDFRHSKGRL
WAELDAKVVVSSREGGYDKGEERIGDYVYFTRVVPGHDSNAIGFYRKRFG
EVDLLAEELINPLFLQQHFGYKDCSIGICRVSEDGRYLAYTLSVEGGDRY
LCHIRSVDNATLFHVIRGTNIVSIEFGSGNQFFYTESNELNRPHRVMMQE
IRPGILEPPVEIYRDDDEQFFVDVRKTKDNKYVTITSDSKVNCNALVVPA
SFPAIPTPLKSFFKEGKPLEIAGKSGWNWLDHYNGNFVMVTSDKGPNYRV
VYIRDEVALAYGKEAEWKELVPHRDNVQIDDVDLFHGRIILHESHFAFER
IQHIRVIKCDGGLDAAAQTPRSEDVVLHFPPLSTVTPGLNKNFRQKAMSF
VYSSLIQPPRDCVFNFDSDITSSQARLCASEALFTQRQSEHFTPWDYMWP
YSIYRDVCVSEDGTEIPITICQRRDAFIQEATDFEAQPNTPKHCLIYVYG
SYGEVPSMHFQLAPYMWMLRRRWTVAFAHVRGGGELPNWAQLGKGENKIK
SIQDFIACCEHMVDMGYTKPELMVAAGASAGCVPIAAAMNMRGCGLFGNV
LMRSPFLDIINTMIDSNLPLSIAEREDWGDPLNNKRDLDLLKQYDPYYNL
NDRVTYPGMMISACLDDDRVPAWNALKYVAKLRQQRTRKDVDPVARPLVL
RMRPSGGHYFWGDTENICEELAFLCSQLDLEGPGKMLNDMDVMTHMHNLT
VTGAMDHDDQQKVFLKWDNWERERIDYHVKLNSFNWEPNFRAVKARKEPF
FWVPTDSELDQKKVDEIFRAKERDARESVRSGAKVGGFGRATGRNLYQEE
QRGKP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAALFPWVPTSNLGYSLSRRAVNKWCPQLRTSYPLPMLDGPLPTEKPEGL
ELHGETQKPDPFRYMEDLFDRNTQEYTKKEMQHFSLISSKFDFRHSKGRL
WAELDAKVVVSSREGGYDKGEERIGDYVYFTRVVPGHDSNAIGFYRKRFG
EVDLLAEELINPLFLQQHFGYKDCSIGICRVSEDGRYLAYTLSVEGGDRY
LCHIRSVDNATLFHVIRGTNIVSIEFGSGNQFFYTESNELNRPHRVMMQE
IRPGILEPPVEIYRDDDEQFFVDVRKTKDNKYVTITSDSKVNCNALVVPA
SFPAIPTPLKSFFKEGKPLEIAGKSGWNWLDHYNGNFVMVTSDKGPNYRV
VYIRDEVALAYGKEAEWKELVPHRDNVQIDDVDLFHGRIILHESHFAFER
IQHIRVIKCDGGLDAAAQTPRSEDVVLHFPPLSTVTPGLNKNFRQKAMSF
VYSSLIQPPRDCVFNFDSDITSSQARLCASEALFTQRQSEHFTPWDYMWP
YSIYRDVCVSEDGTEIPITICQRRDAFIQEATDFEAQPNTPKHCLIYVYG
SYGEVPSMHFQLAPYMWMLRRRWTVAFAHVRGGGELPNWAQLGKGENKIK
SIQDFIACCEHMVDMGYTKPELMVAAGASAGCVPIAAAMNMRGCGLFGNV
LMRSPFLDIINTMIDSNLPLSIAEREDWGDPLNNKRDLDLLKQYDPYYNL
NDRVTYPGMMISACLDDDRVPAWNALKYVAKLRQQRTRKDVDPVARPLVL
RMRPSGGHYFWGDTENICEELAFLCSQLDLEGPGKMLNDMDVMTHMHNLT
VTGAMDHDDQQKVFLKWDNWERERIDYHVKLNSFNWEPNFRAVKARKEPF
FWVPTDSELDQKKVDEIFRAKERDARESVRSGAKVGGFGRATGRNLYQEE
QRGKP


References
    Title: Comparative genomic analysis of three Leishmania species that cause diverse human disease
    Peacock CS, Seeger K, Harris D, Murphy L, Ruiz JC, Quail MA, Peters N, Adlem E, Tivey A and Berriman M <32 more author(s)>
    Ref: Nat Genet, 39:839, 2007 : PubMed

            

    Title: Oligopeptidase B from L. amazonensis: molecular cloning, gene expression analysis and molecular model
    de Matos Guedes HL, Carneiro MP, de Oliveira Gomes DC, Rossi-Bergmanmn B, de Simone SG
    Ref: Parasitol Res, 101:853, 2007 : PubMed

            

    Title: The genome of the kinetoplastid parasite, Leishmania major
    Ivens AC, Peacock CS, Worthey EA, Murphy L, Aggarwal G, Berriman M, Sisk E, Rajandream MA, Adlem E and Myler PJ <91 more author(s)>
    Ref: Science, 309:436, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer