Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lepde-ACHE1

Leptinotarsa decemlineata (Colorado potato beetle) (Doryphora decemlineata) Acetylcholinesterase 1

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Leptinotarsa decemlineata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Coleoptera: N E > Polyphaga: N E > Cucujiformia: N E > Chrysomeloidea: N E > Chrysomelidae: N E > Chrysomelinae: N E > Doryphorini: N E > Leptinotarsa: N E > Leptinotarsa decemlineata: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : JF343436, AEI70751
1 UniProt : F8TTP2
1 UniProt : F8TTP2
1 Interpro : F8TTP2
1 Prodom : F8TTP2
1 Pfam : F8TTP2
1 PIRSF : F8TTP2
1 SUPERFAM : F8TTP2
Sequence
Graphical view for this peptide sequence: lepde-ACHE1
Colored MSA for ACHE (raw)
MTTTLRVFCLLTTMILIPSSLPNPHRGRHHSPEPHAGAYHISRDPFDPHR
DSEEFRRDAPDDGKRDFTRRDSSEDDPLVVQTKRGKVRGVTVTAVTGKKV
DAWLGIPYAQKPIGNLRFRHPRPIEKWDGILNTTSQSTSCVQIIDTVFGD
FAGSNMWNPNTPLSEDCLFVNVVVPKPRPTNAAVLVWIFGGGFYSGTTTL
DIYDHNIIVSEENIILVSMQYRLASLGFLYFGTSDVPGNAGMFDQMMALQ
WIKDNIAAFGGNPNNITLFGESAGAVSVSLHLFSPLSRNLFSQAIMQSGT
ATAPWAIISREESILRGLRLAEAVGCPHDRSDLSSVIDCLQKKDPIELVD
NEWSTLGICEFPFVPVIDGVFLDEHPARSLANKNFKKTNILVGSNSDEGS
SFIMYHLTELFRKEENVYVNRQEFLQAVAELNPYVNPISRQAIVFEYTDW
LNPDDPVSNRDALDKMVGDYQFTCSVNELAHRYSDTGNNVYMYYYKHRSI
ASPWPTWSGAIHGEEINYLFGEPLNPSKSYTPQEVDLSRRMMRYWANFAK
TGNPSVNANGVWTPTFWPIHTAFGREYLTLDINSTATGQGPRLKQCAFWK
KYLPQLQKMTAELQNTQSSKDCVSLGISISSSWYTLSSFSITLLGIGWKR
YQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTTTLRVFCLLTTMILIPSSLPNPHRGRHHSPEPHAGAYHISRDPFDPHR
DSEEFRRDAPDDGKRDFTRRDSSEDDPLVVQTKRGKVRGVTVTAVTGKKV
DAWLGIPYAQKPIGNLRFRHPRPIEKWDGILNTTSQSTSCVQIIDTVFGD
FAGSNMWNPNTPLSEDCLFVNVVVPKPRPTNAAVLVWIFGGGFYSGTTTL
DIYDHNIIVSEENIILVSMQYRLASLGFLYFGTSDVPGNAGMFDQMMALQ
WIKDNIAAFGGNPNNITLFGESAGAVSVSLHLFSPLSRNLFSQAIMQSGT
ATAPWAIISREESILRGLRLAEAVGCPHDRSDLSSVIDCLQKKDPIELVD
NEWSTLGICEFPFVPVIDGVFLDEHPARSLANKNFKKTNILVGSNSDEGS
SFIMYHLTELFRKEENVYVNRQEFLQAVAELNPYVNPISRQAIVFEYTDW
LNPDDPVSNRDALDKMVGDYQFTCSVNELAHRYSDTGNNVYMYYYKHRSI
ASPWPTWSGAIHGEEINYLFGEPLNPSKSYTPQEVDLSRRMMRYWANFAK
TGNPSVNANGVWTPTFWPIHTAFGREYLTLDINSTATGQGPRLKQCAFWK
KYLPQLQKMTAELQNTQSSKDCVSLGISISSSWYTLSSFSITLLGIGWKR
YQ


References
    Title: Characterization of molecular and kinetic properties of two acetylcholinesterases from the Colorado potato beetle, Leptinotarsa decemlineata
    Yoon KA, Kim JH, Nauen R, Alyokhin A, Clark JM, Lee SH
    Ref: Pestic Biochem Physiol, 185:105137, 2022 : PubMed

            

    Title: Contribution of Ldace1 gene to acetylcholinesterase activity in Colorado potato beetle
    Revuelta L, Ortego F, Diaz-Ruiz JR, Castanera P, Tenllado F, Hernandez-Crespo P
    Ref: Insect Biochemistry & Molecular Biology, 41:795, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer