Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lepsm-ACHE1A

Lepeophtheirus salmonis (Salmon louse). Acetylcholinesterase 1A

Comment
OP-resistance;azamethiphos resistance;Kaur_2015_PLos.One_10_e0124220 Mutation found in one of the two copies of ace1 in this species of copepod. It could play a role in azamethiphos sensivity. The position is 362 in the protein corresponding to 331 in Torpedo. The mutation pre-dates organophosphate use in salmon farming


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Lepeophtheirus salmonis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Crustacea: N E > Maxillopoda: N E > Copepoda: N E > Neocopepoda: N E > Podoplea: N E > Siphonostomatoida: N E > Caligidae: N E > Lepeophtheirus: N E > Lepeophtheirus salmonis: N E


Molecular evidence
Database
1 mutation: lepsm-ACHE1A
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KJ132368
1 UniProt : A0A0A7E9D3
2 UniProt : A0A0A7E9D3, A0A0K2UQT0
2 Interpro : A0A0A7E9D3, A0A0K2UQT0
2 Prodom : A0A0A7E9D3, A0A0K2UQT0
2 Pfam : A0A0A7E9D3, A0A0K2UQT0
2 PIRSF : A0A0A7E9D3, A0A0K2UQT0
2 SUPERFAM : A0A0A7E9D3, A0A0K2UQT0
Sequence
Graphical view for this peptide sequence: lepsm-ACHE1A
Colored MSA for ACHE (raw)
MWIQVRKQNFGLYFNKILVYLLTLSWSVGAIVQDNLVITTKKGKIRGVTL
KSATNREVDAWYGIPYAQPPVGNLRFRHPRHIDAWEGIKETTRPPNSCIQ
VVDTLFPGFEGAEMWNVNTEPSEDCLYLSVHVPKPRPTGSAVLVWIYGGG
FYSGTSTLEVYDPRVLVSEENIIFVAMQYRVASLGFLFFDTEDVPGNAGL
YDQMMALQWVKNNIEEFGGDPDKITIFGESAGGCSVALHLLSPLSRNLFS
QAIMQSASALVPWGVITKKESIIRGRRLAEMMSCPYDEKNTKAMIECLRQ
KDATEMVNQEWIGIISGIAEFPFVPIVDGSFLDESPGKSLTTKNYKKTNI
LIGANKEEGNYFIMYYLTDLFKNTESVYVDRTDFIRSVSELNHYVKKMGR
EAITFEYTDWLNPNDPIKNREAIDRMVGDYQFICPTADFARIYASTGNNV
YMYYFTERSSTSPWPTWSGVLHGDEIAFVFGEALNKSKNYDKSEIALSKR
MMGYWANFAKTGNPSLSADGTWSTNYWPLHTPTKQEVLELNANYSRVLEG
LRVKKCAFWKKYLPKLLSLTSNNGDHQCQTSSTSSPSCCKDGTCCNSGTS
FASTFFSVFIVTTSVHLFYNFKFSVIYSNINNGKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWIQVRKQNFGLYFNKILVYLLTLSWSVGAIVQDNLVITTKKGKIRGVTL
KSATNREVDAWYGIPYAQPPVGNLRFRHPRHIDAWEGIKETTRPPNSCIQ
VVDTLFPGFEGAEMWNVNTEPSEDCLYLSVHVPKPRPTGSAVLVWIYGGG
FYSGTSTLEVYDPRVLVSEENIIFVAMQYRVASLGFLFFDTEDVPGNAGL
YDQMMALQWVKNNIEEFGGDPDKITIFGESAGGCSVALHLLSPLSRNLFS
QAIMQSASALVPWGVITKKESIIRGRRLAEMMSCPYDEKNTKAMIECLRQ
KDATEMVNQEWIGIISGIAEFPFVPIVDGSFLDESPGKSLTTKNYKKTNI
LIGANKEEGNYFIMYYLTDLFKNTESVYVDRTDFIRSVSELNHYVKKMGR
EAITFEYTDWLNPNDPIKNREAIDRMVGDYQFICPTADFARIYASTGNNV
YMYYFTERSSTSPWPTWSGVLHGDEIAFVFGEALNKSKNYDKSEIALSKR
MMGYWANFAKTGNPSLSADGTWSTNYWPLHTPTKQEVLELNANYSRVLEG
LRVKKCAFWKKYLPKLLSLTSNNGDHQCQTSSTSSPSCCKDGTCCNSGTS
FASTFFSVFIVTTSVHLFYNFKFSVIYSNINNGKL


References
    Title: The mechanism (Phe362Tyr mutation) behind resistance in Lepeophtheirus salmonis pre-dates organophosphate use in salmon farming
    Kaur K, Besnier F, Glover KA, Nilsen F, Aspehaug VT, Fjortoft HB, Horsberg TE
    Ref: Sci Rep, 7:12349, 2017 : PubMed

            

    Title: Mechanism behind Resistance against the Organophosphate Azamethiphos in Salmon Lice (Lepeophtheirus salmonis)
    Kaur K, Helgesen KO, Bakke MJ, Horsberg TE
    Ref: PLoS ONE, 10:e0124220, 2015 : PubMed

            

    Title: Identification and Molecular Characterization of Two Acetylcholinesterases from the Salmon Louse, Lepeophtheirus salmonis
    Kaur K, Bakke MJ, Nilsen F, Horsberg TE
    Ref: PLoS ONE, 10:e0125362, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer