Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lepsm-c1bs03

Lepeophtheirus salmonis (Salmon louse). Probable serine hydrolase

Relationship
Family|SERHL
Block| X
Position in NCBI Life Tree|Lepeophtheirus salmonis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Crustacea: N E > Maxillopoda: N E > Copepoda: N E > Neocopepoda: N E > Podoplea: N E > Siphonostomatoida: N E > Caligidae: N E > Lepeophtheirus: N E > Lepeophtheirus salmonis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : BT077382
1 UniProt : C1BS03
1 UniProt : C1BS03
1 Interpro : C1BS03
1 Prodom : C1BS03
1 Pfam : C1BS03
1 PIRSF : C1BS03
1 SUPERFAM : C1BS03
Sequence
Graphical view for this peptide sequence: lepsm-c1bs03
Colored MSA for SERHL (raw)
MSNWSGEEFTIPVPWGVIAGRKWGDSKGHPWLALHGWLDNAGTFDKLVPL
FPKNHRLYCIDYPGHGFSSHIPKGMMYHFMESTSYLRRIANHLNLDKYSL
MGHSFGGAISMIHTGIDSEPISHVISIDLIRPYVVESNVIVESAKNSIDT
LFTIERKFEMEPEKVYSYEEVFKKLELALNRSNNQPHKSKDSIDTLLKRG
LQKSKCGEGFILTRDARHLVPTLQRLTPQLYKEVLKRINVPHMIIKSDKS
LFYGDEEEVMENVKLLKDSNPMFEYVLVDGYHHVHLDDPKKVITHIENFL
NKYPV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNWSGEEFTIPVPWGVIAGRKWGDSKGHPWLALHGWLDNAGTFDKLVPL
FPKNHRLYCIDYPGHGFSSHIPKGMMYHFMESTSYLRRIANHLNLDKYSL
MGHSFGGAISMIHTGIDSEPISHVISIDLIRPYVVESNVIVESAKNSIDT
LFTIERKFEMEPEKVYSYEEVFKKLELALNRSNNQPHKSKDSIDTLLKRG
LQKSKCGEGFILTRDARHLVPTLQRLTPQLYKEVLKRINVPHMIIKSDKS
LFYGDEEEVMENVKLLKDSNPMFEYVLVDGYHHVHLDDPKKVITHIENFL
NKYPV



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer