Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lepsv-e2j7j8

Lepidium sativum (Garden cress) Gibberellin receptor 1b

Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Lepidium sativum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Lepidieae: N E > Lepidium: N E > Lepidium sativum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : HQ003456
1 UniProt : E2J7J8
1 UniProt : E2J7J8
1 Interpro : E2J7J8
1 Prodom : E2J7J8
1 Pfam : E2J7J8
1 PIRSF : E2J7J8
1 SUPERFAM : E2J7J8
Sequence
Graphical view for this peptide sequence: lepsv-e2j7j8
Colored MSA for Plant_carboxylesterase (raw)
MAGGNEVNLNECKRIVPLNTWVLISNFKLAYNILRRPDGSFNRDLAEFLD
RKVPANAFPVDGVFSFDHVDSTTNLLTRIYQPSSLFDQTLHGTVELTRPL
STTEIIPVLIFFHGGSFTHSSANSAIYDTFCRRLVSICGVVVVSVDYRRS
PEHRYPCAYDDGWNALKWVKSRIWLQSGKHSNVYVYLAGDSSGGNIAHNV
AVRATKEGVQVLGNILLHPMFGGQERTESEKGLDGKYFVTIQDRDWYWRA
YLPEGEDRDHPACNPFGRRGQSLKGVNFPKSLVVVAGLDLVQDWQLAYVD
GLKKTGHEVNLLYLKQATIGFYFLPNNDHFHCLMEELNKFVHSIEDYERK
SNPVLLTL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAGGNEVNLNECKRIVPLNTWVLISNFKLAYNILRRPDGSFNRDLAEFLD
RKVPANAFPVDGVFSFDHVDSTTNLLTRIYQPSSLFDQTLHGTVELTRPL
STTEIIPVLIFFHGGSFTHSSANSAIYDTFCRRLVSICGVVVVSVDYRRS
PEHRYPCAYDDGWNALKWVKSRIWLQSGKHSNVYVYLAGDSSGGNIAHNV
AVRATKEGVQVLGNILLHPMFGGQERTESEKGLDGKYFVTIQDRDWYWRA
YLPEGEDRDHPACNPFGRRGQSLKGVNFPKSLVVVAGLDLVQDWQLAYVD
GLKKTGHEVNLLYLKQATIGFYFLPNNDHFHCLMEELNKFVHSIEDYERK
SNPVLLTL


Reference
    Title: Members of the gibberellin receptor gene family GID1 (GIBBERELLIN INSENSITIVE DWARF1) play distinct roles during Lepidium sativum and Arabidopsis thaliana seed germination
    Voegele A, Linkies A, Muller K, Leubner-Metzger G
    Ref: J Exp Bot, 62:5131, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer