(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Firmicutes: NE > Bacilli: NE > Bacillales: NE > Listeriaceae: NE > Listeria: NE > Listeria innocua: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Listeria innocua FSL S4-378: N, E.
Listeria innocua FSL J1-023: N, E.
Listeria innocua ATCC 33091: N, E.
Listeria innocua Clip11262: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MEHIFIPGKNNNLAPLLLLHGTGGDEKSLVEIAEFINSDAAVLSLRGDIK EGGANRFFKRFHDGSLDLEDLELKTAELSKTTRELAEQYQLDFERMIAVG YSNGANIAANALLQAEDSFHKAILFHAMPAGNKQPEFSISHRNVFLSAGL NDPLITAKASEELVEILEKRGAKVETVWTAAGHSLTMEELEEAKKWYQNN QK
Listeria monocytogenes is a food-borne pathogen with a high mortality rate that has also emerged as a paradigm for intracellular parasitism. We present and compare the genome sequences of L. monocytogenes (2,944,528 base pairs) and a nonpathogenic species, L. innocua (3,011,209 base pairs). We found a large number of predicted genes encoding surface and secreted proteins, transporters, and transcriptional regulators, consistent with the ability of both species to adapt to diverse environments. The presence of 270 L. monocytogenes and 149 L. innocua strain-specific genes (clustered in 100 and 63 islets, respectively) suggests that virulence in Listeria results from multiple gene acquisition and deletion events.