Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lisin-LIN0976

Listeria innocua, Listeria welshimeri, Listeria seeligeri, hypothetical protein lin0976

Comment
Other strains: Listeria innocua Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) Listeria seeligeri serovar 1/2b (strain ATCC 35967 / DSM 20751 / CI 100100 / SLCC 3954)


Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Listeria innocua
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria innocua: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AL596167, AM263198, FN557490
1 UniProt : A0AH96
2 UniProt : Q92D44, A0AH96
2 Interpro : Q92D44, A0AH96
2 Prodom : Q92D44, A0AH96
2 Pfam : Q92D44, A0AH96
2 PIRSF : Q92D44, A0AH96
2 SUPERFAM : Q92D44, A0AH96
Sequence
Graphical view for this peptide sequence: lisin-LIN0976
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MTAHKMLDEKFYSKLLGEELDLIICLPPDFSPLYKYPLFIVQDGKDYFQF
GKLARHSEELAVNEQIQKAIFIGIPYKTVMDRREKYHPDGEQNEAYIRFL
AFELVPYLEERFPSFQMPTSRFLMGDSLGASVSLKAALLFPFTFGNVILH
SPYVDDAILTLAEKADPAKVKIYHIIGDQETAVETTGDEILDFLSPNKSL
EQILTSRGFDYYFRVFNGDHRWKYWQPFIKESLQFMLPVNTFDLESMRA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTAHKMLDEKFYSKLLGEELDLIICLPPDFSPLYKYPLFIVQDGKDYFQF
GKLARHSEELAVNEQIQKAIFIGIPYKTVMDRREKYHPDGEQNEAYIRFL
AFELVPYLEERFPSFQMPTSRFLMGDSLGASVSLKAALLFPFTFGNVILH
SPYVDDAILTLAEKADPAKVKIYHIIGDQETAVETTGDEILDFLSPNKSL
EQILTSRGFDYYFRVFNGDHRWKYWQPFIKESLQFMLPVNTFDLESMRA


References
    Title: Complete genome sequence of Listeria seeligeri, a nonpathogenic member of the genus Listeria
    Steinweg C, Kuenne CT, Billion A, Mraheil MA, Domann E, Ghai R, Barbuddhe SB, Karst U, Goesmann A and Hain T <7 more author(s)>
    Ref: Journal of Bacteriology, 192:1473, 2010 : PubMed

            

    Title: Whole-genome sequence of Listeria welshimeri reveals common steps in genome reduction with Listeria innocua as compared to Listeria monocytogenes
    Hain T, Steinweg C, Kuenne CT, Billion A, Ghai R, Chatterjee SS, Domann E, Karst U, Goesmann A and Chakraborty T <12 more author(s)>
    Ref: Journal of Bacteriology, 188:7405, 2006 : PubMed

            

    Title: Comparative genomics of Listeria species
    Glaser P, Frangeul L, Buchrieser C, Rusniok C, Amend A, Baquero F, Berche P, Bloecker H, Brandt P and Cossart P <45 more author(s)>
    Ref: Science, 294:849, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer