Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lisin-LIN1782

Listeria innocua lin1782 protein 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase

Comment
Other strains: Listeria innocua (and strains FSL S4-378; FSL J1-023; ATCC 33091)


Relationship
Family|MenH_SHCHC
Block| X
Position in NCBI Life Tree|Listeria innocua
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria innocua: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AL596169, ADXG01001193, ADXH01000600
1 UniProt : H1GEA0
2 UniProt : Q92AY6, H1GEA0
2 Interpro : Q92AY6, H1GEA0
2 Prodom : Q92AY6, H1GEA0
2 Pfam : Q92AY6, H1GEA0
2 PIRSF : Q92AY6, H1GEA0
2 SUPERFAM : Q92AY6, H1GEA0
Sequence
Graphical view for this peptide sequence: lisin-LIN1782
Colored MSA for MenH_SHCHC (raw)
MLVNGQHYHLINDISGEKPVLLMLHGFTGSSETFQDSISLLKEHFSIIAP
DLLGHGKTSCPKEVARYSIENICDDLASILHQLKIDSCFVLGYSMGGRVA
TAFAAKYKELVRGLVLVSSSPGLRDEKARASRISADNRLADTLDADGIEP
FVAYWENLALFASQKNLPFALKKRIRLERLAQNPHGLAKSLRGMGTGKQP
SYWENLADFTFPVLLITGNLDEKFEKIAREMKQLLPNSTHVTVQEAGHAV
YLEQPNIFSSQLIYWLEGILKEEEK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLVNGQHYHLINDISGEKPVLLMLHGFTGSSETFQDSISLLKEHFSIIAP
DLLGHGKTSCPKEVARYSIENICDDLASILHQLKIDSCFVLGYSMGGRVA
TAFAAKYKELVRGLVLVSSSPGLRDEKARASRISADNRLADTLDADGIEP
FVAYWENLALFASQKNLPFALKKRIRLERLAQNPHGLAKSLRGMGTGKQP
SYWENLADFTFPVLLITGNLDEKFEKIAREMKQLLPNSTHVTVQEAGHAV
YLEQPNIFSSQLIYWLEGILKEEEK


Reference
    Title: Comparative genomics of Listeria species
    Glaser P, Frangeul L, Buchrieser C, Rusniok C, Amend A, Baquero F, Berche P, Bloecker H, Brandt P and Cossart P <45 more author(s)>
    Ref: Science, 294:849, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer