Gene_locus Report for: lisml-e1u8v0Listeria monocytogenes serotype 4c (strain L99) serotype 4a (strain HCC23) Hydrolase, alpha/beta fold family Comment Other strains: Listeria monocytogenes serotype 4a (strain M7; HCC23); serotype 4c (strain L99) Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria monocytogenes: N E
6_AlphaBeta_hydrolase : lismf-q71xq4Listeria monocytogenes (serotype 4b / strain F2365; H7858) hydrolase, alpha/beta fold family, lismo-LMO0752Listeria monocytogenes (and strain 4b H7858) hypothetical protein lmo0752, lismo-LMO1128Listeria monocytogenes hypothetical protein lmo1128, lismo-LMO2109Listeria monocytogenes (and strain 1/2a F6854) hypothetical protein lmo2109, lismo-LMO2453Listeria monocytogenes (and strains 1/2a F6854; 4b H7858) Listeria welshimeri serovar 6b ATCC 35897 / DSM 20650 ) hypothetical protein lmo2453, lismo-LMO2677Listeria monocytogenes (and strains 1/2a F6854; 4b H7858) hypothetical protein lmo2677. A85-EsteraseD-FGH : lismo-LMO2433Listeria monocytogenes, hypothetical protein lmo2433. A85-IroE-IroD-Fes-Yiel : lismo-LMO0977Listeria monocytogenes, hypothetical protein lmo0977. AlphaBeta_hydrolase : lismo-LMO1511Listeria monocytogenes hypothetical protein lmo1511, lismo-LMO2074Listeria monocytogenes hypothetical protein lmo2074. CarbLipBact_1 : lismo-LMO2450Listeria monocytogenes hypothetical protein lmo2450, lismo-LMO2452Listeria monocytogenes, Listeria welshimeri, Listeria seeligeri, Listeria marthii, Listeria innocua, Listeria ivanovii, hypothetical protein lmo2452. CarbLipBact_2 : lismo-LMO0857Listeria monocytogenes, Listeria marthii, Listeria seeligeri, hypothetical protein lmo0857. Cocaine_esterase : lismo-LMO0493Listeria monocytogenes, Listeria seeligeri, hypothetical protein lmo0493, lismo-LMO2755Listeria monocytogenes, Hydrolase, CocE/NonD family hypothetical protein lmo2755. Duf_915 : lismo-LMO0950Listeria monocytogenes, hypothetical protein lmo0950, lismo-LMO0951Listeria monocytogenes, Listeria marthii, hypothetical protein lmo0951, lismo-LMO2578Listeria monocytogenes hypothetical protein lmo2578. Homoserine_transacetylase : lismo-metxListeria monocytogenes, Listeria innocua, Listeria welshimeri, Listeria marthii, Listeria seeligeri, hypothetical protein lmo0594 homoserine o-acetyltransferase (EC 2.3.1.31). Hormone-sensitive_lipase_like : lismo-LMO0110Listeria monocytogenes hypothetical protein lmo0110, lismo-LMO2089Listeria monocytogenes, Listeria innocua, Listeria marthii, Listeria welshimeri, hypothetical protein lmo2089. LYsophospholipase_carboxylesterase : lismo-LMO0580Listeria monocytogenes, hypothetical protein lmo0580, lismo-LMO0760Listeria monocytogenes (and strains serotype 4b F2365; 4b H7858; 1/2a F6854) hypothetical protein lmo0760. Mbeg1-like : lismc-c1l0d9Listeria monocytogenes, Listeria innocua, Putative uncharacterized protein. MenH_SHCHC : lismo-d3kmm7Listeria monocytogenes FSL J2-071 Hydrolase, lismo-e3ygy8Listeria monocytogenes FSL F2-208 Shchc synthase, lismo-LMO1674Listeria monocytogenes, protein lmo1674. Monoglyceridelipase_lysophospholip : lismo-LMO1258Listeria monocytogenes, Listeria innocua, lin1226 hypothetical protein lmo1258. yjfP_esterase-like : lismo-LMO2262Listeria monocytogenes hypothetical protein lmo2262 Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Listeria monocytogenes L99: N, E.
Listeria monocytogenes HCC23: N, E.
Listeria monocytogenes M7: N, E.
Listeria monocytogenes FSL J2-071: N, E.
Listeria monocytogenes FSL J1-194: N, E.
Listeria monocytogenes HPB2262: N, E.
Listeria monocytogenes FSL N1-017: N, E.
Listeria monocytogenes FSL F2-208: N, E.
Listeria monocytogenes J1816: N, E.
Listeria monocytogenes J1-220: N, E.
Listeria monocytogenes str. Scott A: N, E.
Listeria monocytogenes serotype 4b str. LL195: N, E.
Listeria monocytogenes serotype 4b str. CLIP 80459: N, E.
Listeria monocytogenes serotype 4b str. F2365: N, E.
Listeria monocytogenes FSL R2-503: N, E.
Listeria monocytogenes serotype 4b str. H7858: N, E.
Listeria monocytogenes serotype 1/2a str. F6854: N, E.
Listeria monocytogenes F6900: N, E.
Listeria monocytogenes J2818: N, E.
Listeria monocytogenes 08-5923: N, E.
Listeria monocytogenes 08-5578: N, E.
Listeria monocytogenes FSL N3-165: N, E.
Listeria monocytogenes EGD-e: N, E.
Listeria monocytogenes J0161: N, E.
Listeria monocytogenes 10403S: N, E.
Listeria monocytogenes FSL R2-561: N, E.
Listeria monocytogenes Finland 1998: N, E.
Listeria monocytogenes FSL J1-208: N, E.
Listeria monocytogenes 07PF0776: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: lisml-e1u8v0
Colored MSA for MenH_SHCHC (raw)
MLVRGKQYQFTNVISGEKPFLLMLHGFTGTSRTFQASISRLKERFNIIAP
DLLGHGNTASPEEIAPYAMESICEDLAGILQQLNVTRCFVLGYSMGGRVA
TAFAATYPEMVRGLILVSSSPGLVEVDLRVNRVQADNRLADKLEAEGIES
FVDYWEDLALFASQKVLPDEVNERIRAERLSQNSHGLAMSLRGMGTGKQP
SYWDHLVNFTFPVLLITGALDGKFENIAREMQQLLPNSTHVIVPAAGHAV
YLEQPNIFSSQLINWLEVILKEEEK
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MLVRGKQYQFTNVISGEKPFLLMLHGFTGTSRTFQASISRLKERFNIIAP
DLLGHGNTASPEEIAPYAMESICEDLAGILQQLNVTRCFVLGYSMGGRVA
TAFAATYPEMVRGLILVSSSPGLVEVDLRVNRVQADNRLADKLEAEGIES
FVDYWEDLALFASQKVLPDEVNERIRAERLSQNSHGLAMSLRGMGTGKQP
SYWDHLVNFTFPVLLITGALDGKFENIAREMQQLLPNSTHVIVPAAGHAV
YLEQPNIFSSQLINWLEVILKEEEK
|
|
|
|
