(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Firmicutes: NE > Bacilli: NE > Bacillales: NE > Listeriaceae: NE > Listeria: NE > Listeria monocytogenes: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Listeria monocytogenes serotype 4b str. F2365: N, E.
Listeria monocytogenes FSL J2-071: N, E.
Listeria monocytogenes FSL J1-194: N, E.
Listeria monocytogenes HPB2262: N, E.
Listeria monocytogenes FSL N1-017: N, E.
Listeria monocytogenes L99: N, E.
Listeria monocytogenes FSL F2-208: N, E.
Listeria monocytogenes J1816: N, E.
Listeria monocytogenes J1-220: N, E.
Listeria monocytogenes str. Scott A: N, E.
Listeria monocytogenes serotype 4b str. LL195: N, E.
Listeria monocytogenes M7: N, E.
Listeria monocytogenes serotype 4b str. CLIP 80459: N, E.
Listeria monocytogenes FSL R2-503: N, E.
Listeria monocytogenes serotype 4b str. H7858: N, E.
Listeria monocytogenes HCC23: N, E.
Listeria monocytogenes serotype 1/2a str. F6854: N, E.
Listeria monocytogenes F6900: N, E.
Listeria monocytogenes J2818: N, E.
Listeria monocytogenes 08-5923: N, E.
Listeria monocytogenes 08-5578: N, E.
Listeria monocytogenes FSL N3-165: N, E.
Listeria monocytogenes EGD-e: N, E.
Listeria monocytogenes J0161: N, E.
Listeria monocytogenes 10403S: N, E.
Listeria monocytogenes FSL R2-561: N, E.
Listeria monocytogenes Finland 1998: N, E.
Listeria monocytogenes FSL J1-208: N, E.
Listeria monocytogenes 07PF0776: N, E.
Listeria welshimeri serovar 6b str. SLCC5334: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MIAEINGINLFYQIIGKGEPILLIHGNGQNHRSLKRMIDDLSTNHQVIAV DSRAHGKSEAGNTPLDFEVMALDMLSLLDYLKIDKYKVIGYSDGGIVALV MGKMQPNRQIASVVIGTNYHVNQIRFLPDLFCRVAYGAAFLLAPFSRFFE RMKRQLALTIYHPHMSEADLQKISAPLLAVVGEYDLISSKDTRKMVHSVQ HGEMVIVRNGLHYLPRQKPKQLLQLIHSFFSNLSAEIHK
We present the complete genome sequence of Listeria welshimeri, a nonpathogenic member of the genus Listeria. Listeria welshimeri harbors a circular chromosome of 2,814,130 bp with 2,780 open reading frames. Comparative genomic analysis of chromosomal regions between L. welshimeri, Listeria innocua, and Listeria monocytogenes shows strong overall conservation of synteny, with the exception of the translocation of an F(o)F(1) ATP synthase. The smaller size of the L. welshimeri genome is the result of deletions in all of the genes involved in virulence and of "fitness" genes required for intracellular survival, transcription factors, and LPXTG- and LRR-containing proteins as well as 55 genes involved in carbohydrate transport and metabolism. In total, 482 genes are absent from L. welshimeri relative to L. monocytogenes. Of these, 249 deletions are commonly absent in both L. welshimeri and L. innocua, suggesting similar genome evolutionary paths from an ancestor. We also identified 311 genes specific to L. welshimeri that are absent in the other two species, indicating gene expansion in L. welshimeri, including horizontal gene transfer. The species L. welshimeri appears to have been derived from early evolutionary events and an ancestor more compact than L. monocytogenes that led to the emergence of nonpathogenic Listeria spp.
The genomes of three strains of Listeria monocytogenes that have been associated with food-borne illness in the USA were subjected to whole genome comparative analysis. A total of 51, 97 and 69 strain-specific genes were identified in L.monocytogenes strains F2365 (serotype 4b, cheese isolate), F6854 (serotype 1/2a, frankfurter isolate) and H7858 (serotype 4b, meat isolate), respectively. Eighty-three genes were restricted to serotype 1/2a and 51 to serotype 4b strains. These strain- and serotype-specific genes probably contribute to observed differences in pathogenicity, and the ability of the organisms to survive and grow in their respective environmental niches. The serotype 1/2a-specific genes include an operon that encodes the rhamnose biosynthetic pathway that is associated with teichoic acid biosynthesis, as well as operons for five glycosyl transferases and an adenine-specific DNA methyltransferase. A total of 8603 and 105 050 high quality single nucleotide polymorphisms (SNPs) were found on the draft genome sequences of strain H7858 and strain F6854, respectively, when compared with strain F2365. Whole genome comparative analyses revealed that the L.monocytogenes genomes are essentially syntenic, with the majority of genomic differences consisting of phage insertions, transposable elements and SNPs.
Listeria monocytogenes is a food-borne pathogen with a high mortality rate that has also emerged as a paradigm for intracellular parasitism. We present and compare the genome sequences of L. monocytogenes (2,944,528 base pairs) and a nonpathogenic species, L. innocua (3,011,209 base pairs). We found a large number of predicted genes encoding surface and secreted proteins, transporters, and transcriptional regulators, consistent with the ability of both species to adapt to diverse environments. The presence of 270 L. monocytogenes and 149 L. innocua strain-specific genes (clustered in 100 and 63 islets, respectively) suggests that virulence in Listeria results from multiple gene acquisition and deletion events.
