Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lisse-e3zni8

Listeria seeligeri FSL N1-067 Alpha/beta fold family hydrolase

Relationship
Family|CarbLipBact_2
Block| X
Position in NCBI Life Tree|Listeria seeligeri
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria seeligeri: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ADXJ01000453
1 UniProt : E3ZNI8
1 UniProt : E3ZNI8
1 Interpro : E3ZNI8
1 Pfam : E3ZNI8
1 PIRSF : E3ZNI8
1 SUPERFAM : E3ZNI8
Sequence
Graphical view for this peptide sequence: lisse-e3zni8
Colored MSA for CarbLipBact_2 (raw)
MVACLCIHGFTGSPTEVKPLADYLREHTDWDVLAPTLPGHDHLRHLKNVT
YKDWIVFVDSILSQMLKEDEEVYIIGFSMGGLLAGWLARHYPQVKKLVLL
STAVNALEWPQIVGNSKQLLAEAKEVKLKNSPMFKRYQKKVTETPPASTL
QFEKMVALARPAFEHIEIPTFIAQGSKDSVIPAEKSVQFLMDSIPGPKEL
FMLEGSEHAICHDKEADQLFAAVLTFLQKDLAVLNVK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVACLCIHGFTGSPTEVKPLADYLREHTDWDVLAPTLPGHDHLRHLKNVT
YKDWIVFVDSILSQMLKEDEEVYIIGFSMGGLLAGWLARHYPQVKKLVLL
STAVNALEWPQIVGNSKQLLAEAKEVKLKNSPMFKRYQKKVTETPPASTL
QFEKMVALARPAFEHIEIPTFIAQGSKDSVIPAEKSVQFLMDSIPGPKEL
FMLEGSEHAICHDKEADQLFAAVLTFLQKDLAVLNVK


Reference
    Title: Comparative genomics of the bacterial genus Listeria: Genome evolution is characterized by limited gene acquisition and limited gene loss
    den Bakker HC, Cummings CA, Ferreira V, Vatta P, Orsi RH, Degoricija L, Barker M, Petrauskene O, Furtado MR, Wiedmann M
    Ref: BMC Genomics, 11:688, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer