Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lisss-d3unw0

Listeria seeligeri serovar 1/2b (strain ATCC 35967 / DSM 20751 / CI100100 / SLCC 3954) Hydrolase protein

Relationship
Family|MenH_SHCHC
Block| X
Position in NCBI Life Tree|Listeria seeligeri
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria seeligeri: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: lisss-d3unw0
Colored MSA for MenH_SHCHC (raw)
MQINGQKYHVSTFFSAEEKPVLLMLHGFTGTSGTYYDAIKSLKERYNIVA
PDLLGHGRTANPDEQERYLMEHTCEDLAEILRQLEIQQCFVLGYSMGGRV
ATGFAASHPEKVQGLILISSSPGLLHEVDREKRMLADNQLADRIEQNGIQ
AFVDYWENLPLFTSQRNLPSDKQAKIRKERLEQKPIGLAMSLRGIGTGKQ
ASYWDHLRNFTFPVLLITGELDAKFENTAQEMLQHLPNATHVTIKQAGHA
AYLEQPTTFLSQINNWLEVNLKEEEK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQINGQKYHVSTFFSAEEKPVLLMLHGFTGTSGTYYDAIKSLKERYNIVA
PDLLGHGRTANPDEQERYLMEHTCEDLAEILRQLEIQQCFVLGYSMGGRV
ATGFAASHPEKVQGLILISSSPGLLHEVDREKRMLADNQLADRIEQNGIQ
AFVDYWENLPLFTSQRNLPSDKQAKIRKERLEQKPIGLAMSLRGIGTGKQ
ASYWDHLRNFTFPVLLITGELDAKFENTAQEMLQHLPNATHVTIKQAGHA
AYLEQPTTFLSQINNWLEVNLKEEEK


Reference
    Title: Complete genome sequence of Listeria seeligeri, a nonpathogenic member of the genus Listeria
    Steinweg C, Kuenne CT, Billion A, Mraheil MA, Domann E, Ghai R, Barbuddhe SB, Karst U, Goesmann A and Hain T <7 more author(s)>
    Ref: Journal of Bacteriology, 192:1473, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer