Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: litct-a0a2g9sm06

Lithobates catesbeiana (American bullfrog) (Rana catesbeiana). DLH domain-containing protein

Relationship
Family|CMBL
Block| X
Position in NCBI Life Tree|Lithobates catesbeiana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amphibia: N E > Batrachia: N E > Anura: N E > Neobatrachia: N E > Ranoidea: N E > Ranidae: N E > Rana: N E > Aquarana: N E > Rana catesbeiana: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KV922904
1 UniProt : A0A2G9SM06
1 UniProt : A0A2G9SM06
1 Interpro : A0A2G9SM06
1 Pfam : A0A2G9SM06
1 PIRSF : A0A2G9SM06
1 SUPERFAM : A0A2G9SM06
Sequence
Graphical view for this peptide sequence: litct-a0a2g9sm06
Colored MSA for CMBL (raw)
MANEARPCPCELGDQFDYKGLGEEVQIEHIKAYVTKPKTTTDKAIIVVQD
VYGWELTNTRYFVDLLAEHGYTAVLADFFVGQEPWKTTNDRSTFFAWLET
RPADKAFKQVDAVLRYLKEKCHATKIGIIGFCWGGIVTHYVTLNYPELKA
GVAFYGLVREEVESLDQKLKENSKVDYKVKVYPKQNHGFAHRKKEEISPE
DKPYILEARKDMLDWLKKYFA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MANEARPCPCELGDQFDYKGLGEEVQIEHIKAYVTKPKTTTDKAIIVVQD
VYGWELTNTRYFVDLLAEHGYTAVLADFFVGQEPWKTTNDRSTFFAWLET
RPADKAFKQVDAVLRYLKEKCHATKIGIIGFCWGGIVTHYVTLNYPELKA
GVAFYGLVREEVESLDQKLKENSKVDYKVKVYPKQNHGFAHRKKEEISPE
DKPYILEARKDMLDWLKKYFA


Reference
    Title: The North American bullfrog draft genome provides insight into hormonal regulation of long noncoding RNA
    Hammond SA, Warren RL, Vandervalk BP, Kucuk E, Khan H, Gibb EA, Pandoh P, Kirk H, Zhao Y and Birol I <11 more author(s)>
    Ref: Nat Commun, 8:1433, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer