Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lolop-ACHE1

Loligo opalescens (California market squid) acetylcholinesterase precursor, mRNA, partial cds

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Loligo opalescens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Lophotrochozoa: N E > Mollusca: N E > Cephalopoda: N E > Coleoidea: N E > Neocoleoidea: N E > Decapodiformes: N E > Teuthida: N E > Myopsina: N E > Loliginidae: N E > Doryteuthis: N E > Doryteuthis opalescens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AF065384, AAD15886
1 Ncbi-nid : 4321937
1 Ncbi-pid : 4321938
1 UniProt : O97110
1 Interpro : O97110
1 Prodom : O97110
1 Pfam : O97110
1 PIRSF : O97110
1 SUPERFAM : O97110
Sequence
Graphical view for this peptide sequence: lolop-ACHE1
Colored MSA for ACHE (raw)
MELSRFIDFLRVSGVYILCLFVLAEAYNSDPIISTSKGKVRGLRINVYDK
QVDAFLGIPFAKPPVGNLRFRHPVPNDPWTGIYDATRKPNSCIQGFDRIF
TNFSGETMWHANTQLSEDCLYLNVWVPRNDKSKKKKAVMVWIYGGGFYSG
TSTLDVYDPRHLVAENDIIFVSMQYRVSAFGFLALGIPEAPGNAGMFDQL
MALDWVQRNIKFFGGNPQNVTLFGESAGAASVAFHLLSPLSRPKFDRAIL
QSGSVTCAWAVTTREEAFRRAKTLARQFKCPVLDTAMDVYQCLKAQPADE
FPDHEWWVIQGISQFPFVLVVDGTFLVEAPEIALERHAFKKVPILVGTNK
NEGTYFLTYFRQDIFNLKDSALISKSIFRLLLDTLVEYYPKYPHSLNSFG
RDAILYQYTHWADPDDMLHNRNMIDQLVADYHFLCQVNEMANAYSAAGQK
VFYYHYTQVSSQSPWPEWVGAYHAAEIDFVFGQPMDRSKNFLPKEMELSR
KMMRFWTNFAKTGDPNYDWDRQSAKNEWPSHTASGREYILLDAKHVHNFK
VSKGLRSKECAFWKEYLPQLVAATSEQYGNITCTGGAVPTQPTMHAVVLS
SLMLFLPGLF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MELSRFIDFLRVSGVYILCLFVLAEAYNSDPIISTSKGKVRGLRINVYDK
QVDAFLGIPFAKPPVGNLRFRHPVPNDPWTGIYDATRKPNSCIQGFDRIF
TNFSGETMWHANTQLSEDCLYLNVWVPRNDKSKKKKAVMVWIYGGGFYSG
TSTLDVYDPRHLVAENDIIFVSMQYRVSAFGFLALGIPEAPGNAGMFDQL
MALDWVQRNIKFFGGNPQNVTLFGESAGAASVAFHLLSPLSRPKFDRAIL
QSGSVTCAWAVTTREEAFRRAKTLARQFKCPVLDTAMDVYQCLKAQPADE
FPDHEWWVIQGISQFPFVLVVDGTFLVEAPEIALERHAFKKVPILVGTNK
NEGTYFLTYFRQDIFNLKDSALISKSIFRLLLDTLVEYYPKYPHSLNSFG
RDAILYQYTHWADPDDMLHNRNMIDQLVADYHFLCQVNEMANAYSAAGQK
VFYYHYTQVSSQSPWPEWVGAYHAAEIDFVFGQPMDRSKNFLPKEMELSR
KMMRFWTNFAKTGDPNYDWDRQSAKNEWPSHTASGREYILLDAKHVHNFK
VSKGLRSKECAFWKEYLPQLVAATSEQYGNITCTGGAVPTQPTMHAVVLS
SLMLFLPGLF


Reference
    Title: Molecular cloning and expression of a full-length cDNA encoding acetylcholinesterase in optic lobes of the squid Loligo opalescens: a new member of the cholinesterase family resistant to diisopropyl fluorophosphate
    Talesa V, Grauso M, Arpagaus M, Giovannini E, Romani R, Rosi G
    Ref: Journal of Neurochemistry, 72:1250, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer