Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: luccu-ACHE

Lucilia cuprina (Green bottle fly) (Australian sheep blowfly) acetylcholinesterase

Comment
Cterminus H peptide many differences


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Lucilia cuprina
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Calyptratae: N E > Oestroidea: N E > Calliphoridae: N E > Luciliinae: N E > Lucilia: N E > Lucilia cuprina: N E


Molecular evidence
Database
9 mutations: Table (e.g. : F115S/I199V/F368Y, F115S, F368Y ... more)
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : U88631, JF776371
1 UniProt : F5CR23
1 Ncbi-nid : 1872535
1 Ncbi-pid : 1872536
3 UniProt : P91954, F5CR23, A0A0L0BUT2
3 Interpro : P91954, F5CR23, A0A0L0BUT2
3 Prodom : P91954, F5CR23, A0A0L0BUT2
3 Pfam : P91954, F5CR23, A0A0L0BUT2
3 PIRSF : P91954, F5CR23, A0A0L0BUT2
3 SUPERFAM : P91954, F5CR23, A0A0L0BUT2
Sequence
Graphical view for this peptide sequence: luccu-ACHE
Colored MSA for ACHE (raw)
MEFEIFFLFVYLKQQISSGASTIMARFITTSSSPTLTTSTAATAPSSSWS
SNATSTATSISSHSRTSRKSRYTSSNLLNAFASLTSRSSLSLSSTSSNDL
YRGFLTTLVILLRMSSVAYGITDRLIVQTTSGPVRGRAVTVQGREVHVFT
GIPYAKPPVDDLRFRKPVPAEPWHGVLDATRLPATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYMNIWAPAKARLRHGRGANGGEHSSKTDPDHLIHSA
TPQNTTNGLPILIWIYGGGFMTGSATLDIYNADIYSVGNVSVASFQYRVG
AFGFLHLSPVMPGFEEEAPGNVGLWDQALALRWLKENARAFGGNPEWMTL
FGESAGSSSVNAQLASPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGK
ALINDCNCNASLLPANPQSVMACMRAVDAKTISVQQWNSYSGILSFPSAP
TIDGAFLPADPMTLMKTADMSGYDIMIGNVKDEGTYFLLYDFIDYFDKDE
ATSLPRDKYLEIMNNIFNKATQAEREAIIFQYTSWEGNPGYQNQQQNGRA
VGDHFFTCPTNEYAQALAERGAQVHYYYFTHRTSTSLWGEWMGVLHGDEI
EYFFGQPLNTSLQYRAVERELGKRMLNSVIEFAKTGNPAVDGEEWPNFSK
EDPVYYVFSTDEKTEKLQRGPLAKRCSFWNDYLPKVRSWVGSECENNSAE
SAAVSIIYEKQQNLLKWVIMLTIMVTCIFQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEFEIFFLFVYLKQQISSGASTIMARFITTSSSPTLTTSTAATAPSSSWS
SNATSTATSISSHSRTSRKSRYTSSNLLNAFASLTSRSSLSLSSTSSNDL
YRGFLTTLVILLRMSSVAYGITDRLIVQTTSGPVRGRAVTVQGREVHVFT
GIPYAKPPVDDLRFRKPVPAEPWHGVLDATRLPATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYMNIWAPAKARLRHGRGANGGEHSSKTDPDHLIHSA
TPQNTTNGLPILIWIYGGGFMTGSATLDIYNADIYSVGNVSVASFQYRVG
AFGFLHLSPVMPGFEEEAPGNVGLWDQALALRWLKENARAFGGNPEWMTL
FGESAGSSSVNAQLASPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGK
ALINDCNCNASLLPANPQSVMACMRAVDAKTISVQQWNSYSGILSFPSAP
TIDGAFLPADPMTLMKTADMSGYDIMIGNVKDEGTYFLLYDFIDYFDKDE
ATSLPRDKYLEIMNNIFNKATQAEREAIIFQYTSWEGNPGYQNQQQNGRA
VGDHFFTCPTNEYAQALAERGAQVHYYYFTHRTSTSLWGEWMGVLHGDEI
EYFFGQPLNTSLQYRAVERELGKRMLNSVIEFAKTGNPAVDGEEWPNFSK
EDPVYYVFSTDEKTEKLQRGPLAKRCSFWNDYLPKVRSWVGSECENNSAE
SAAVSIIYEKQQNLLKWVIMLTIMVTCIFQ


References
    Title: The acetylcholinesterase gene and organophosphorus resistance in the Australian sheep blowfly, Lucilia cuprina
    Chen Z, Newcomb RD, Forbes E, McKenzie J, Batterham P
    Ref: Insect Biochemistry & Molecular Biology, 31:805, 2001 : PubMed

            

    Title: A single amino acid substitution converts a carboxylesterase to an organophosphorus hydrolase and confers insecticide resistance on a blowfly
    Newcomb RD, Campbell PM, Ollis DL, Cheah E, Russell RJ, Oakeshott JG
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 94:7464, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer