Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lyces-Q9ZWF3

Lycopersicon esculentum (Tomato) dna, similar to hsr203j

Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Lycopersicon esculentum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Solanales: N E > Solanaceae: N E > Solanoideae: N E > Solaneae: N E > Solanum: N E > Lycopersicon: N E > Solanum lycopersicum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AB022689, BAA74434, AEKE03003138
1 UniProt : A0A3Q7F3E2
2 UniProt : Q9ZWF3, A0A3Q7F3E2
2 Interpro : Q9ZWF3, A0A3Q7F3E2
2 Prodom : Q9ZWF3, A0A3Q7F3E2
2 Pfam : Q9ZWF3, A0A3Q7F3E2
2 PIRSF : Q9ZWF3, A0A3Q7F3E2
2 SUPERFAM : Q9ZWF3, A0A3Q7F3E2
Sequence
Graphical view for this peptide sequence: lyces-Q9ZWF3
Colored MSA for Plant_carboxylesterase (raw)
MVHQKQVKDVVSGWLTVFDDGSVDRTWTGPPEVKFMAEPVPPHDDFIDGV
AVKDVVAGENSGSRFRIYLPERNDSSVDKLPVILHFHGGGFCISQADWFM
YYAVYTRLARVANAIVVSVFLPLAPEHRLPAACDAGFAGLLWLRDVSREQ
GHEPWLNEYADFNRVFLIGDSSGGNVVHQVAARAGEEDLSPMKLAGAIPI
HPGFMRSQRSKSELEQEQTPFLTLDMVDKFMELALPIGSTKDHPITCPMG
DAAPAVEELKLPPYLYCVAEKDLIEDTEMEFYESLKTGEKDVELLINNGV
GHSFYLNKIAVDMDPVTGSATEKLFEAIAEFINKH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVHQKQVKDVVSGWLTVFDDGSVDRTWTGPPEVKFMAEPVPPHDDFIDGV
AVKDVVAGENSGSRFRIYLPERNDSSVDKLPVILHFHGGGFCISQADWFM
YYAVYTRLARVANAIVVSVFLPLAPEHRLPAACDAGFAGLLWLRDVSREQ
GHEPWLNEYADFNRVFLIGDSSGGNVVHQVAARAGEEDLSPMKLAGAIPI
HPGFMRSQRSKSELEQEQTPFLTLDMVDKFMELALPIGSTKDHPITCPMG
DAAPAVEELKLPPYLYCVAEKDLIEDTEMEFYESLKTGEKDVELLINNGV
GHSFYLNKIAVDMDPVTGSATEKLFEAIAEFINKH


References
    Title: The tomato genome sequence provides insights into fleshy fruit evolution
    Sato S, Tomato Genome Consortium
    Ref: Nature, 485:635, 2012 : PubMed

            

    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer