Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lyghe-a0a0a9z9l8

Lygus hesperus (Western plant bug). Neuroligin-4, X-linked

Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Lygus hesperus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Prosorrhyncha: N E > Heteroptera: N E > Euheteroptera: N E > Neoheteroptera: N E > Panheteroptera: N E > Cimicomorpha: N E > Cimicoidea: N E > Miridae: N E > Mirinae: N E > Mirini: N E > Lygus: N E > Lygus hesperus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: lyghe-a0a0a9z9l8
Colored MSA for Neuroligin (raw)
SGFTRSVSVHDDRMRFVLYLFLLFFGAVEGHWTERGKTREVHIQQGLIRG
LVAGWDHPNLRSVEIYRGIPYAAAPVGTLRYIPPQSPQPWGDASGPVRMT
EEFAPVCPQILPTIERDRKKMTQGQANQLKRIIPYLKAQNEDCLTLNIYA
PLQELERDMGMMTKKAVLVFIHGESFSWGSGNPYDGSVLASYGDIIVVTV
NYRLGVFGFLKSSSKVSNLGLLDQIAALKWLKDNIWKFGGDNNTITLMGH
HTGAVAVNHLMFSPIVIADPTPGLFQRVILMSGSALASWSEMTEPDRNMK
SVANQLDCELSTDDSFQECLRDKTVGELLNLNFPDEFGPSVGDMVLPGEN
VKTSPQYKGFYSRYDMLCGVTENECYDMLDAVSLHNGMLEKDRDKILSEF
FNSSFKSYPQLVQKRATEFYSKAGNTFRAQPYYVARDTVLGILNDVRVVN
PVIQTALHHSNSNPLAQTFLYVFTHKSSKSEYTGTDESVQGEELPYIFGV
PLGGQINHFQSSYNHHEKLLSEVMMTMWSNFVKTGDPNSPRKYNYLTLTA
RDWAYFEKLKWPIFEAHNQSYYKFALRPSIGSWYRSEYMEFWNSDLPAYL
DKHEKNLNEREDNFFFRTPFVKSNPGRPYGREPERPSQVWPDPPSRPFNS
GPYGTVINYPSESREKRPGSFYKLPTLKPRVHEVMEEDVPEEPSEAEDSE
NSEGAKHIDTASSFALSVILIVGVAFVVVNIFLFVFFIRQKRKLCISSNY
PGRFGCGPSPSLPESNIEARDEKYEIKSILKSADQLYDAVVKRTEEWPDI
YRPGSSSTVTIDPHTKVAEWMGQKVKNTNLKQTNLARERTDRSSDTDNAS
AATTSKACEKKAVKKVSVAIDATPSARSASVLKQIPIELTKSLDFGRGRF
GMGKLRKEGAISEDDSPLPSHKHSLSDPADFPPPPPTASLSERMLSSFNP
HSVDINVTSRDEHQPHPMSPEEALDNIKRRNFPKVLPDFPDDEPEGAARL
KRMSLPQSAETLKELGRKNPPPPPPRVSTLARKPTSNRNSVPNHMMVQRD
IESIHDREKHESKRDKSNKI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SGFTRSVSVHDDRMRFVLYLFLLFFGAVEGHWTERGKTREVHIQQGLIRG
LVAGWDHPNLRSVEIYRGIPYAAAPVGTLRYIPPQSPQPWGDASGPVRMT
EEFAPVCPQILPTIERDRKKMTQGQANQLKRIIPYLKAQNEDCLTLNIYA
PLQELERDMGMMTKKAVLVFIHGESFSWGSGNPYDGSVLASYGDIIVVTV
NYRLGVFGFLKSSSKVSNLGLLDQIAALKWLKDNIWKFGGDNNTITLMGH
HTGAVAVNHLMFSPIVIADPTPGLFQRVILMSGSALASWSEMTEPDRNMK
SVANQLDCELSTDDSFQECLRDKTVGELLNLNFPDEFGPSVGDMVLPGEN
VKTSPQYKGFYSRYDMLCGVTENECYDMLDAVSLHNGMLEKDRDKILSEF
FNSSFKSYPQLVQKRATEFYSKAGNTFRAQPYYVARDTVLGILNDVRVVN
PVIQTALHHSNSNPLAQTFLYVFTHKSSKSEYTGTDESVQGEELPYIFGV
PLGGQINHFQSSYNHHEKLLSEVMMTMWSNFVKTGDPNSPRKYNYLTLTA
RDWAYFEKLKWPIFEAHNQSYYKFALRPSIGSWYRSEYMEFWNSDLPAYL
DKHEKNLNEREDNFFFRTPFVKSNPGRPYGREPERPSQVWPDPPSRPFNS
GPYGTVINYPSESREKRPGSFYKLPTLKPRVHEVMEEDVPEEPSEAEDSE
NSEGAKHIDTASSFALSVILIVGVAFVVVNIFLFVFFIRQKRKLCISSNY
PGRFGCGPSPSLPESNIEARDEKYEIKSILKSADQLYDAVVKRTEEWPDI
YRPGSSSTVTIDPHTKVAEWMGQKVKNTNLKQTNLARERTDRSSDTDNAS
AATTSKACEKKAVKKVSVAIDATPSARSASVLKQIPIELTKSLDFGRGRF
GMGKLRKEGAISEDDSPLPSHKHSLSDPADFPPPPPTASLSERMLSSFNP
HSVDINVTSRDEHQPHPMSPEEALDNIKRRNFPKVLPDFPDDEPEGAARL
KRMSLPQSAETLKELGRKNPPPPPPRVSTLARKPTSNRNSVPNHMMVQRD
IESIHDREKHESKRDKSNKI


Reference
    Title: Transcriptome-based identification of ABC transporters in the western tarnished plant bug Lygus hesperus
    Hull JJ, Chaney K, Geib SM, Fabrick JA, Brent CS, Walsh D, Lavine LC
    Ref: PLoS ONE, 9:e113046, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer