Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: maceu-c3s7e4

Macropus eugenii (Tammar wallaby) NDRG family member 2

Relationship
Family|Ndr_family
Block| X
Position in NCBI Life Tree|Macropus eugenii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Metatheria: N E > Diprotodontia: N E > Macropodidae: N E > Notamacropus: N E > Notamacropus eugenii: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : EU677471
1 UniProt : C3S7E4
1 UniProt : C3S7E4
1 Interpro : C3S7E4
1 Prodom : C3S7E4
1 Pfam : C3S7E4
1 PIRSF : C3S7E4
1 SUPERFAM : C3S7E4
Sequence
Graphical view for this peptide sequence: maceu-c3s7e4
Colored MSA for Ndr_family (raw)
MAELQEVHITEEKPLLPGQTPEAAKTHSVETPYGSITFTVYGTPKPKRPA
IFTYHDVGLNYKTCFKPLFDFGDMQEIIKNFVRVHVEAPGMEEGAPVFPL
GYQYPSLDQLADMIPPILQYLNFSTIIGVGVGAGAYILSRFALLNPDVVE
GLVLINIDCNAKGWMDWAAHKLTGLTSSVSDMILQHLFSQEELSGHSELV
QRYRDIITHAPNLENIELFWNSYNNRRDLHFERRGDATLKCPVMLVVGDQ
APYEDAVVECNSKLDPTKTSFLKMADSGGQPQLTQPGKLTEAFKYFVQGM
GYMASSCMTRLSRSRTASLTSRASIDSGRSRTTSQSSESGIVPSGSPGQT
MEVSS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAELQEVHITEEKPLLPGQTPEAAKTHSVETPYGSITFTVYGTPKPKRPA
IFTYHDVGLNYKTCFKPLFDFGDMQEIIKNFVRVHVEAPGMEEGAPVFPL
GYQYPSLDQLADMIPPILQYLNFSTIIGVGVGAGAYILSRFALLNPDVVE
GLVLINIDCNAKGWMDWAAHKLTGLTSSVSDMILQHLFSQEELSGHSELV
QRYRDIITHAPNLENIELFWNSYNNRRDLHFERRGDATLKCPVMLVVGDQ
APYEDAVVECNSKLDPTKTSFLKMADSGGQPQLTQPGKLTEAFKYFVQGM
GYMASSCMTRLSRSRTASLTSRASIDSGRSRTTSQSSESGIVPSGSPGQT
MEVSS


Reference
    Title: Cross-fostering of the tammar wallaby (Macropus eugenii) pouch young accelerates fore-stomach maturation
    Kwek JH, Iongh RD, Digby MR, Renfree MB, Nicholas KR, Familari M
    Ref: Mech Dev, 126:449, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer