Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: macmu-BCHE

Macaca mulatta butyrylcholinesterase

Relationship
Family|BCHE
Block| C
Position in NCBI Life Tree|Macaca mulatta
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Cercopithecoidea: N E > Cercopithecidae: N E > Cercopithecinae: N E > Macaca: N E > Macaca mulatta: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: M62777, JU335747, JU335748
>3 UniProt links 2 more: P32751, F6UC09, F6S099
1 Ncbi-nid : 342078
>3 UniProt links 2 more: P32751, F6UC09, F6S099
>3 Interpro links 2 more: P32751, F6UC09, F6S099
>3 Pfam links 2 more: P32751, F6UC09, F6S099
>3 PIRSF links 2 more: P32751, F6UC09, F6S099
>3 SUPERFAM links 2 more: P32751, F6UC09, F6S099
Sequence
Graphical view for this peptide sequence: macmu-BCHE
Colored MSA for BCHE (raw)
MHSKVTIICIRLLFWFLLLCMLIGKSHTEDDIVIATKNGKVRGMNLTVLG
GTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCYQNIDQS
FPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVMIWIYGGGFQTGT
SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ
LALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHPLFTRAIL
QSGSSNAPWAVTSLYEARNRTLTLAKLTGCSRDNETEIVKCLRNKDPHEI
LLNEAFVVPYGTLLSVNFGPTMDGDFLTEMPDILLELGQFKKTQILVGVN
KDEGTAFLVYGAPGFSKDNDSIITRNEFQEGLKIFFPGVSEFGKESILFH
YTDWVDDQRPENYREALDDVVGDYNIICPALEFTKKFSWGNNAFFYYFEH
RSSKLPWPEWMGVMHGYEIEFVFGLPLERRVNYTKAEEILSRSIVKRWAN
FAKYGNPNGTHNNSTKWPVFKSTEQKYLTLNTESSRILTKLRAQQCRFWT
SFFPKVLEMTGNIDEAEWEWKAGFHRWSNYMMDWKNQFNDYTSKKESCVG
L
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHSKVTIICIRLLFWFLLLCMLIGKSHTEDDIVIATKNGKVRGMNLTVLG
GTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCYQNIDQS
FPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVMIWIYGGGFQTGT
SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ
LALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHPLFTRAIL
QSGSSNAPWAVTSLYEARNRTLTLAKLTGCSRDNETEIVKCLRNKDPHEI
LLNEAFVVPYGTLLSVNFGPTMDGDFLTEMPDILLELGQFKKTQILVGVN
KDEGTAFLVYGAPGFSKDNDSIITRNEFQEGLKIFFPGVSEFGKESILFH
YTDWVDDQRPENYREALDDVVGDYNIICPALEFTKKFSWGNNAFFYYFEH
RSSKLPWPEWMGVMHGYEIEFVFGLPLERRVNYTKAEEILSRSIVKRWAN
FAKYGNPNGTHNNSTKWPVFKSTEQKYLTLNTESSRILTKLRAQQCRFWT
SFFPKVLEMTGNIDEAEWEWKAGFHRWSNYMMDWKNQFNDYTSKKESCVG
L


References
    Title: Genome sequencing and comparison of two nonhuman primate animal models, the cynomolgus and Chinese rhesus macaques
    Yan G, Zhang G, Fang X, Zhang Y, Li C, Ling F, Cooper DN, Li Q, Li Y and Wang X <32 more author(s)>
    Ref: Nat Biotechnol, 29:1019, 2011 : PubMed

            

    Title: Evolutionary and biomedical insights from the rhesus macaque genome
    Gibbs RA, Rogers J, Katze MG, Bumgarner R, Weinstock GM, Mardis ER, Remington KA, Strausberg RL, Venter JC and Zwieg AS <166 more author(s)>
    Ref: Science, 316:222, 2007 : PubMed

            

    Title: Use of the polymerase chain reaction for homology probing of butyrylcholinesterase from several vertebrates
    Arpagaus M, Chatonnet A, Masson P, Newton M, Vaughan TA, Bartels CF, Nogueira CP, La Du BN, Lockridge O
    Ref: Journal of Biological Chemistry, 266:6966, 1991 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer