Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: macmu-f7ai42

Macaca mulatta (Rhesus macaque) Uncharacterized protein

Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Macaca mulatta
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Cercopithecoidea: N E > Cercopithecidae: N E > Cercopithecinae: N E > Macaca: N E > Macaca mulatta: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 UniProt : F7AI42, F7AI34
2 UniProt : F7AI42, F7AI34
2 Interpro : F7AI42, F7AI34
2 Prodom : F7AI42, F7AI34
2 Pfam : F7AI42, F7AI34
2 PIRSF : F7AI42, F7AI34
2 SUPERFAM : F7AI42, F7AI34
Sequence
Graphical view for this peptide sequence: macmu-f7ai42
Colored MSA for Carb_B_Chordata (raw)
MWLRALVLATLAAFTAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAVF
LGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCSQDAVAGQVLSEL
FTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLMVGAAS
TYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQLAALHW
VQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVA
LTAVLVKKGDVKPLAEQIAIAAGCQTTTSAVMVHCLRQKTEEELLETTLK
MKFFSLDLHGDPRESHPFLGTLIDGLLLPKTPEELQAERKFNTVPYMVGF
NKQEFGWIIPMSMGYPLSEGKLDQKTAMSLLWKSYPLVYIAKELIPEAIE
KYLGGTDDPVKKKDLFLDLIADVMFCVPSVIVARHHRDAGAPTYMYEFQY
RPSFSSDMKPKMVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWA
NFARNGNPNGEGLPHWPEYNQEEGYLQIGANTQAAQKLKDKEVAFWTKLF
AKMAVEKPPQTEHIEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWLRALVLATLAAFTAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAVF
LGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCSQDAVAGQVLSEL
FTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIHGGGLMVGAAS
TYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQLAALHW
VQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVA
LTAVLVKKGDVKPLAEQIAIAAGCQTTTSAVMVHCLRQKTEEELLETTLK
MKFFSLDLHGDPRESHPFLGTLIDGLLLPKTPEELQAERKFNTVPYMVGF
NKQEFGWIIPMSMGYPLSEGKLDQKTAMSLLWKSYPLVYIAKELIPEAIE
KYLGGTDDPVKKKDLFLDLIADVMFCVPSVIVARHHRDAGAPTYMYEFQY
RPSFSSDMKPKMVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWA
NFARNGNPNGEGLPHWPEYNQEEGYLQIGANTQAAQKLKDKEVAFWTKLF
AKMAVEKPPQTEHIEL


Reference
    Title: Evolutionary and biomedical insights from the rhesus macaque genome
    Gibbs RA, Rogers J, Katze MG, Bumgarner R, Weinstock GM, Mardis ER, Remington KA, Strausberg RL, Venter JC and Zwieg AS <166 more author(s)>
    Ref: Science, 316:222, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer