Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: maize-b4fv80

Zea mays (Maize). Carboxymethylenebutenolidase

Relationship
Family|CMBL
Block| X
Position in NCBI Life Tree|Zea mays
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > PACMAD clade: N E > Panicoideae: N E > Andropogonodae: N E > Andropogoneae: N E > Tripsacinae: N E > Zea: N E > Zea mays: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: maize-b4fv80
Colored MSA for CMBL (raw)
MGSTVDDDEACELVSGSDLVIGEGDDSVSAYLFKAVKNNNGTGILLLSDI
FGFQDSATRDFAYRVACNGYNVLVPDLFRGNPWKLNVPFDGDSFERWRAG
QAPGRVSGDIDACTRWLVDEFKAAGVSKKLGVIGFCYGGGRLVETLARDA
ESCFSAGVCFYGSRMDASLGDRVAAPVLFVCGDGDPLCPVETVRELEGRA
RGARAAVYAGRGHGFAHRPQSVEEDGDAEDAFNAMRGWLHDHLLA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGSTVDDDEACELVSGSDLVIGEGDDSVSAYLFKAVKNNNGTGILLLSDI
FGFQDSATRDFAYRVACNGYNVLVPDLFRGNPWKLNVPFDGDSFERWRAG
QAPGRVSGDIDACTRWLVDEFKAAGVSKKLGVIGFCYGGGRLVETLARDA
ESCFSAGVCFYGSRMDASLGDRVAAPVLFVCGDGDPLCPVETVRELEGRA
RGARAAVYAGRGHGFAHRPQSVEEDGDAEDAFNAMRGWLHDHLLA


References
    Title: Extensive intraspecific gene order and gene structural variations between Mo17 and other maize genomes
    Sun S, Zhou Y, Chen J, Shi J, Zhao H, Song W, Zhang M, Cui Y, Dong X and Lai J <16 more author(s)>
    Ref: Nat Genet, 50:1289, 2018 : PubMed

            

    Title: The B73 maize genome: complexity, diversity, and dynamics
    Schnable PS, Ware D, Fulton RS, Stein JC, Wei F, Pasternak S, Liang C, Zhang J, Fulton L and Wilson RK <147 more author(s)>
    Ref: Science, 326:1112, 2009 : PubMed

            

    Title: Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs
    Soderlund C, Descour A, Kudrna D, Bomhoff M, Boyd L, Currie J, Angelova A, Collura K, Wissotski M and Yu Y <4 more author(s)>
    Ref: PLoS Genet, 5:e1000740, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer