Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: maize-b6u7e1

Zea mays (Maize) Esterase/lipase/thioesterase family protein

Relationship
Family|NLS3-Tex30
Block| X
Position in NCBI Life Tree|Zea mays
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > PACMAD clade: N E > Panicoideae: N E > Andropogonodae: N E > Andropogoneae: N E > Tripsacinae: N E > Zea: N E > Zea mays: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: EU973156, BT036353, CM000782
3 UniProt : B6U7E1, B4FGW5, B4FMB2
3 UniProt : B6U7E1, B4FGW5, B4FMB2
3 Interpro : B6U7E1, B4FGW5, B4FMB2
3 Pfam : B6U7E1, B4FGW5, B4FMB2
3 PIRSF : B6U7E1, B4FGW5, B4FMB2
3 SUPERFAM : B6U7E1, B4FGW5, B4FMB2
Sequence
Graphical view for this peptide sequence: maize-b6u7e1
Colored MSA for NLS3-Tex30 (raw)
MAPKRRRADQGSSVPAPPPPLRKAKLQPVVIFAHGAGAPSSSDWMVHWKK
MVQDALDAVAVVTFDYPYMSGGKRRAPPKAEKLVDHHLGIVKDAAVKYQG
HPLILMGKSMGSRVSCMVASSTEVDVSAVVCLGYPLKGVNGAVRDETLLQ
LKVPTMFVQGSKDALCPLDKLLSTQKKMTCKNELHIIDGGDHSFKVGKKY
LESKGLNQHDLEMEAITKISQFFQDSFTESCT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAPKRRRADQGSSVPAPPPPLRKAKLQPVVIFAHGAGAPSSSDWMVHWKK
MVQDALDAVAVVTFDYPYMSGGKRRAPPKAEKLVDHHLGIVKDAAVKYQG
HPLILMGKSMGSRVSCMVASSTEVDVSAVVCLGYPLKGVNGAVRDETLLQ
LKVPTMFVQGSKDALCPLDKLLSTQKKMTCKNELHIIDGGDHSFKVGKKY
LESKGLNQHDLEMEAITKISQFFQDSFTESCT


References
    Title: Insights into corn genes derived from large-scale cDNA sequencing
    Alexandrov NN, Brover VV, Freidin S, Troukhan ME, Tatarinova TV, Zhang H, Swaller TJ, Lu YP, Bouck J and Feldmann KA <1 more author(s)>
    Ref: Plant Mol Biol, 69:179, 2009 : PubMed

            

    Title: The B73 maize genome: complexity, diversity, and dynamics
    Schnable PS, Ware D, Fulton RS, Stein JC, Wei F, Pasternak S, Liang C, Zhang J, Fulton L and Wilson RK <147 more author(s)>
    Ref: Science, 326:1112, 2009 : PubMed

            

    Title: Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs
    Soderlund C, Descour A, Kudrna D, Bomhoff M, Boyd L, Currie J, Angelova A, Collura K, Wissotski M and Yu Y <4 more author(s)>
    Ref: PLoS Genet, 5:e1000740, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer