Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: malci-McFae1

Malbranchea cinnamomea (Thermophilic fungus) (Malbranchea sulfurea) McFae1

Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Malbranchea cinnamomea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Onygenales: N E > Onygenales incertae sedis: N E > Malbranchea: N E > Malbranchea cinnamomea: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: malci-McFae1
Colored MSA for Lipase_3 (raw)
MYAAHTTFRLLATLLFASQAIAKTAITPELFQKIERYTAFSAASYGDTCA
TPPFGSSVVKYFNDDATDTQGTLFRDDANEEIVLAFRGTSTPKDLDTDFA
FTLVPLNAEGTDCPSCKVHEGFQKAYNSISADVISAVESLKQSQPSYSIV
LTGHSLGGGIAAIASSSLVGRGHEIKTYTFGEPRNGDSNFADYLNGQVPP
SDYFRVTHANDGVPQIPPRALGYQHHGTEYWQSNKESNDASSTFQCTGAE
PADCNASQDFGDNPINGAHLGYSNSLIGNSLFIAACGASL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYAAHTTFRLLATLLFASQAIAKTAITPELFQKIERYTAFSAASYGDTCA
TPPFGSSVVKYFNDDATDTQGTLFRDDANEEIVLAFRGTSTPKDLDTDFA
FTLVPLNAEGTDCPSCKVHEGFQKAYNSISADVISAVESLKQSQPSYSIV
LTGHSLGGGIAAIASSSLVGRGHEIKTYTFGEPRNGDSNFADYLNGQVPP
SDYFRVTHANDGVPQIPPRALGYQHHGTEYWQSNKESNDASSTFQCTGAE
PADCNASQDFGDNPINGAHLGYSNSLIGNSLFIAACGASL


Reference
    Title: Fungal feruloyl esterases can catalyze release of diferulic acids from complex arabinoxylan
    Lin S, Hunt CJ, Holck J, Brask J, Krogh K, Meyer AS, Wilkens C, Agger JW
    Ref: Int J Biol Macromol, :123365, 2023 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer