Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: malgo-a8puy1

Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) SMG1, LIP1, secretory lipase (Family 3)

Comment
Malassezia globosa belongs to Malassezia, associated with common skin disorders like dandruff and seborrheic dermatitis (D/SD). SMG1 hydrolyses diolein but not triolein


Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Malassezia globosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Ustilaginomycotina: N E > Malasseziomycetes: N E > Malasseziales: N E > Malasseziaceae: N E > Malassezia: N E > Malassezia globosa: N E


Molecular evidence
Database
No mutation
5 structures (e.g. : 3UUE, 3UUF, 4ZRD... more)
No kinetic





No Substrate
No inhibitor
2 Genbank : AAYY01000002, EDP44990
1 UniProt : A8PUY1
>3 Structure links 2 more: 7SPR, 3UUE, 4ZRD
1 UniProt : A8PUY1
1 Interpro : A8PUY1
1 Prodom : A8PUY1
1 Pfam : A8PUY1
1 PIRSF : A8PUY1
1 SUPERFAM : A8PUY1
Sequence
Graphical view for this peptide sequence: malgo-a8puy1
Colored MSA for Lipase_3 (raw)
MLFSRFVLLAFGSVAAVSASSIYARGRGGSSTDQPVANPYNTKEISLAAG
LVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEG
TNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIF
TAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGL
PRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIY
PGNSTSAKLYPGQENVHGILTVAREFNFDDHQGIYFHTQIGAVMGECPAQ
VGAH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLFSRFVLLAFGSVAAVSASSIYARGRGGSSTDQPVANPYNTKEISLAAG
LVQQTYCDSTENGLKIGDSELLYTMGEGYARQRVNIYHSPSLGIAVAIEG
TNLFSLNSDLHDAKFWQEDPNERYIQYYPKGTKLMHGFQQAYNDLMDDIF
TAVKKYKKEKNEKRVTVIGHSLGAAMGLLCAMDIELRMDGGLYKTYLFGL
PRLGNPTFASFVDQKIGDKFHSIINGRDWVPTVPPRALGYQHPSDYVWIY
PGNSTSAKLYPGQENVHGILTVAREFNFDDHQGIYFHTQIGAVMGECPAQ
VGAH


References
2 more
    Title: Residue Asn277 Affects the Stability and Substrate Specificity of the SMG1 Lipase from Malassezia globosa
    Lan D, Wang Q, Xu J, Zhou P, Yang B, Wang Y
    Ref: Int J Mol Sci, 16:7273, 2015 : PubMed

            

    Title: Crystal structure of a mono- and diacylglycerol lipase from Malassezia globosa reveals a novel lid conformation and insights into the substrate specificity
    Xu T, Liu L, Hou S, Xu J, Yang B, Wang Y, Liu J
    Ref: J Struct Biol, 178:363, 2012 : PubMed

            

    Title: Dandruff-associated Malassezia genomes reveal convergent and divergent virulence traits shared with plant and human fungal pathogens
    Xu J, Saunders CW, Hu P, Grant RA, Boekhout T, Kuramae EE, Kronstad JW, Deangelis YM, Reeder NL and Dawson TL, Jr. <11 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:18730, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer