Gene_locus Report for: medtr-b7fjp5

Medicago truncatula (Barrel medic) (Medicago tribuloides) Putative uncharacterized protein

Relationship

Family	\|	Epoxide_hydrolase
Block	\|	X
Position in NCBI Life Tree	\|	Medicago truncatula

(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > Trifolieae: N E > Medicago: N E > Medicago truncatula: N E

There are 109 a/b hydrolases in Medicago truncatula view in a: Table

6_AlphaBeta_hydrolase : medtr-q1s6d2Medicago truncatula (Barrel medic) alpha/beta hydrolase fold.
A85-EsteraseD-FGH : medtr-b7fj60Medicago truncatula (Barrel medic) (Medicago tribuloides) Putative uncharacterized protein, medtr-b7fl49Medicago truncatula (Barrel medic) (Medicago tribuloides) Putative uncharacterized protein.
ABHD13-BEM46 : medtr-a0a072urp3Medicago truncatula (Barrel medic) (Medicago tribuloides). Alpha/beta-hydrolase superfamily protein.
ABHD17-depalmitoylase : medtr-q2hux9Medicago truncatula (Barrel medic) esterase/lipase/thioesterase.
ABHD18 : medtr-a7uqu0Medicago truncatula (Barrel medic) Putative uncharacterized protein.
Acidic_Lipase : medtr-q6tgc0Medicago truncatula (Barrel medic) triacylglycerol/steryl ester lipase-like protein.
AlphaBeta_hydrolase : medtr-q1s193Medicago truncatula (Barrel medic) alpha/beta hydrolase fold, medtr-q1sbn0Medicago truncatula (Barrel medic) at1g13820, medtr-q1t2k5Medicago truncatula (Barrel medic) alpha/beta hydrolase fold.
Bodyguard : medtr-a0a072vlq4Medicago truncatula (Barrel medic) (Medicago tribuloides) Alpha/beta-hydrolase superfamily protein.
Carboxypeptidase_S10 : medtr-b7fki4Medicago truncatula (Barrel medic) (Medicago tribuloides) Uncharacterized protein, medtr-G7ILY3Medicago truncatula (Barrel medic) (Medicago tribuloides) peptidase s10, serine carboxypeptidase, medtr-G7ILY5Medicago truncatula (Barrel medic) (Medicago tribuloides) peptidase s10, serine carboxypeptidase, medtr-G7IT49Medicago truncatula (Barrel medic) (Medicago tribuloides) peptidase s10, serine carboxypeptidase, medtr-G7IT50Medicago truncatula (Barrel medic) (Medicago tribuloides) peptidase s10, serine carboxypeptidase, medtr-g7itl1Medicago truncatula (Barrel medic) (Medicago tribuloides) Serine carboxypeptidase, medtr-g7iu67Medicago truncatula (Barrel medic) (Medicago tribuloides) Serine carboxypeptidase, medtr-g7j641Medicago truncatula (Barrel medic) (Medicago tribuloides) Serine carboxypeptidase II-3, medtr-g7jtf8Medicago truncatula (Barrel medic) (Medicago tribuloides) Serine carboxypeptidase, medtr-g7jtg2Medicago truncatula (Barrel medic) (Medicago tribuloides) Serine carboxypeptidase, medtr-g7jtg4Medicago truncatula (Barrel medic) (Medicago tribuloides) Serine carboxypeptidase, medtr-g7kem3Medicago truncatula (Barrel medic) (Medicago tribuloides) Serine carboxypeptidase-like protein, medtr-G7KRJ6Medicago truncatula (Barrel medic) peptidase s10, serine carboxypeptidase, medtr-g7ksx5Medicago truncatula (Barrel medic) (Medicago tribuloides) Serine carboxypeptidase-like protein, medtr-g7leb3Medicago truncatula (Barrel medic) (Medicago tribuloides) Uncharacterized protein, medtr-q1sgx5Medicago truncatula (Barrel medic) (Medicago tribuloides) peptidase s10, serine carboxypeptidase, medtr-q6w6r6Medicago truncatula (Barrel medic) (Medicago tribuloides) putative serine carboxypeptidase, medtr-scp1Medicago truncatula (Barrel medic) (Medicago tribuloides). Serine carboxypeptidase 1.
Chlorophyllase_Plant : medtr-b7fmi1Medicago truncatula (Barrel medic) (Medicago tribuloides) Putative uncharacterized protein, medtr-g7kml3Medicago truncatula (Barrel medic) (Medicago tribuloides). Chlorophyllase-1, medtr-a0a072vhg0Medicago truncatula (Barrel medic) (Medicago tribuloides). Chlorophyllase.
CMBL : medtr-q1t171Medicago truncatula (Barrel medic) (Medicago tribuloides) . Carboxymethylenebutenolidase homolog.
DPP4N_Peptidase_S9 : medtr-g7j6w0Medicago truncatula (Barrel medic) Peptidase S9B, dipeptidylpeptidase IV terminal.
Duf_676 : medtr-q1s3y4Medicago truncatula (Barrel medic) hypothetical protein, medtr-q1s746Medicago truncatula (Barrel medic) (esterase/lipase/thioesterase), medtr-q1spi8Medicago truncatula (Barrel medic) Alpha/beta-hydrolase superfamily protein, medtr-q1su07Medicago truncatula (Barrel medic) Serine esterase family protein, putative, medtr-q1szf3Medicago truncatula (Barrel medic) Serine esterase family protein.
Duf_1350 : medtr-a0a072trw1Medicago truncatula (Barrel medic) (Medicago tribuloides) Plant/MCA23-20 protein, medtr-a0a072vdn8Medicago truncatula (Barrel medic) (Medicago tribuloides) DUF1350 family protein, medtr-g7ljd0Medicago truncatula (Barrel medic) (Medicago tribuloides), Putative uncharacterized protein.
Epoxide_hydrolase : medtr-a2q320Medicago truncatula (Barrel medic) (Medicago tribuloides) Epoxide hydrolase, medtr-a2q321Medicago truncatula (Barrel medic) (Medicago tribuloides) Epoxide hydrolase, medtr-b7fjm9Medicago truncatula (Barrel medic) (Medicago tribuloides) Putative uncharacterized protein, medtr-b7fka3Medicago truncatula (Barrel medic) (Medicago tribuloides) Putative uncharacterized protein, medtr-q1sfz2Medicago truncatula (Barrel medic) epoxide hydrolase (alpha/beta hydrolase fold), medtr-q1sfz3Medicago truncatula (Barrel medic) alpha/beta hydrolase fold (alpha/beta hydrolase), medtr-q1sg67Medicago truncatula (Barrel medic) alpha/beta hydrolase fold, medtr-q1sql8Medicago truncatula (Barrel medic) alpha/beta hydrolase fold.
FSH1 : medtr-q1sd74Medicago truncatula (Barrel medic)(Medicago tribuloides); Cicer arietinum (Chickpea) (Garbanzo) hypothetical protein.
Glutamyl_Peptidase_S9 : medtr-g7kst7Medicago truncatula (Barrel medic) (Medicago tribuloides). Glutamyl endopeptidase, putative.
Hydroxynitrile_lyase : medtr-b7fix6Medicago truncatula (Barrel medic) (Medicago tribuloides) Putative uncharacterized protein, medtr-g7k9e1Medicago truncatula (Barrel medic) (Medicago tribuloides) Methyl jasmonate esterase, medtr-g7k9e3Medicago truncatula (Barrel medic) (Medicago tribuloides) Uncharacterized protein, medtr-g7k9e5Medicago truncatula (Barrel medic) (Medicago tribuloides) Esterase PIR7B, medtr-g7k9e8Medicago truncatula (Barrel medic) (Medicago tribuloides) Polyneuridine-aldehyde esterase, medtr-g7k9e9Medicago truncatula (Barrel medic) (Medicago tribuloides) Pentatricopeptide repeat-containing protein, medtr-g7lbp2Medicago truncatula (Barrel medic) (Medicago tribuloides) Methyl jasmonate esterase, medtr-g7lch3Medicago truncatula (Barrel medic) (Medicago tribuloides) Methyl jasmonate esterase, medtr-i3sgp2Medicago truncatula (Barrel medic) (Medicago tribuloides) Uncharacterized protein.
Lipase_3 : medtr-q1sda9Medicago truncatula (Barrel medic) lipase, class 3.
LYsophospholipase_carboxylesterase : medtr-q1s407Medicago truncatula (Barrel medic) phospholipase/carboxylesterase.
Monoglyceridelipase_lysophospholip : medtr-q1rus1Medicago truncatula (Barrel medic) alpha/beta hydrolase, medtr-q1s4m1Medicago truncatula (Barrel medic) alpha/beta hydrolase.
Ndr_family : medtr-g7ib94Medicago truncatula (Barrel medic) (Medicago tribuloides) Pollen-specific protein SF21, medtr-g7ljk8Medicago truncatula (Barrel medic) (Medicago tribuloides) Pollen specific protein SF21, medtr-g7i6w5Medicago truncatula (Barrel medic) (Medicago tribuloides) Pollen-specific protein SF21.
PC-sterol_acyltransferase : medtr-q1s687Medicago truncatula (Barrel medic) lecithin:cholesterol acyltransferase, medtr-q6xsh3Medicago truncatula (Barrel medic) lecithine cholesterol acyltransferase-like protein, medtr-Q8GZM5Medicago truncatula (Barrel medic) (Medicago tribuloides) putative phosphatidylcholine acyltransferase, medtr-q71ce5Medicago truncatula (Barrel medic) lecithine cholesterol acyltransferase-like protein.
Pectinacetylesterase-Notum : medtr-b7fkl0Medicago truncatula (Barrel medic) (Medicago tribuloides) Putative uncharacterized protein, medtr-q2hru2Medicago truncatula (Barrel medic) (Medicago tribuloides) Pectinacetylesterase, medtr-g7kvg4Medicago truncatula (Barrel medic) (Medicago tribuloides). Pectinacetylesterase family protein, medtr-g7iam1Medicago truncatula (Barrel medic) (Medicago tribuloides). Pectinacetylesterase family protein, medtr-g7iam3Medicago truncatula (Barrel medic) (Medicago tribuloides). Pectinacetylesterase family protein, medtr-g7l754Medicago truncatula (Barrel medic) (Medicago tribuloides). Pectinacetylesterase family protein, medtr-g7jr41Medicago truncatula (Barrel medic) (Medicago tribuloides). Pectinacetylesterase family protein, medtr-g7l4f5Medicago truncatula (Barrel medic) (Medicago tribuloides). Pectinacetylesterase family protein, medtr-i3scp6Medicago truncatula (Barrel medic) (Medicago tribuloides). Uncharacterized protein, medtr-g7l755Medicago truncatula (Barrel medic) (Medicago tribuloides). Pectinacetylesterase family protein, medtr-a0a072vyl4Medicago truncatula (Barrel medic) (Medicago tribuloides). Pectinacetylesterase family protein, medtr-g7jwk8Medicago truncatula (Barrel medic) (Medicago tribuloides). Pectinacetylesterase family protein.
Pheophytinase : medtr-g7izm0Medicago truncatula (Barrel medic) (Medicago tribuloides) Alpha/beta hydrolase-fold family protein.
Plant_carboxylesterase : medtr-q1s1e6Medicago truncatula (Barrel medic) esterase/lipase/thioesterase, medtr-q1s5d8Medicago truncatula (Barrel medic) (Medicago tribuloides) alpha/beta hydrolase fold, putative (esterase/lipase/thioesterase), medtr-q1smf6Medicago truncatula (Barrel medic) esterase/lipase/thioesterase, medtr-q1smf7Medicago truncatula (Barrel medic) esterase/lipase/thioesterase, medtr-q1szi1Medicago truncatula (Barrel medic) lipolytic enzyme, medtr-q1szi4Medicago truncatula (Barrel medic) esterase/lipase/thioesterase, medtr-q1szi7Medicago truncatula (Barrel medic) esterase/lipase/thioesterase, medtr-q1szi9Medicago truncatula (Barrel medic) esterase/lipase/thioesterase, medtr-q2hrx9Medicago truncatula (Barrel medic) esterase/lipase/thioesterase, medtr-a0a072uuf6Medicago truncatula (Barrel medic) (Medicago tribuloides). Putative carboxylesterase, medtr-g7zzc3Medicago truncatula (Barrel medic) (Medicago tribuloides). Putative carboxylesterase, medtr-g7ie19Medicago truncatula (Barrel medic) (Medicago tribuloides). 2-hydroxyisoflavanone dehydratase.
Plant_lipase_EDS1-like : medtr-q1s9m3Medicago truncatula (Barrel medic) Enhanced disease susceptibility protein, medtr-a0a072v056Medicago truncatula (Barrel medic) (Medicago tribuloides).. Enhanced disease susceptibility protein.
Proline_iminopeptidase : medtr-b7fl89Medicago truncatula (Barrel medic) (Medicago tribuloides). Putative uncharacterized protein.
RsbQ-like : medtr-MtD14Medicago truncatula (Barrel medic) (Medicago tribuloides) D14 Sigma factor sigb regulation rsbq-like protein Medtr1g018320, medtr-b7fk41Medicago truncatula (Barrel medic) (Medicago tribuloides) KAI2A Putative alpha/Beta hydrolase, strigolactone esterase Medtr5g016150, medtr-q1sed4Medicago truncatula (Barrel medic) KAI2B Medtr4g095310 alpha/beta hydrolase fold.
Triacylglycerol-lipase-OBL1-like : medtr-q1s2a7Medicago truncatula (Barrel medic)(Medicago tribuloides) lipase, putative, medtr-q1sh82Medicago truncatula (Barrel medic)(Medicago tribuloides) lipase, class 3, medtr-a0a072u5k5Medicago truncatula (Barrel medic) (Medicago tribuloides). Triacylglycerol lipase-like protein.
UCP031088 : medtr-a0a072vrv9Medicago truncatula (Barrel medic) (Medicago tribuloides). Alpha/beta fold hydrolase, medtr-g7kmk5Medicago truncatula (Barrel medic) (Medicago tribuloides). Putative alpha/Beta hydrolase

Molecular evidence		Database
No mutation No structure No kinetic No Substrate No inhibitor		1 Genbank : BT052312 1 UniProt : B7FJP5 1 UniProt : B7FJP5 1 Interpro : B7FJP5 1 Pfam : B7FJP5 1 PIRSF : B7FJP5 1 SUPERFAM : B7FJP5

Sequence

Peptide

Graphical view for this peptide sequence: medtr-b7fjp5
Colored MSA for Epoxide_hydrolase (raw)
MENIQHSHVEVKGLKLHVAEIGTGEKVVVFLHGFPEIWYTWRYQMIAVAN AGYRAIAFDFGGYGLSDHPAEPEKATIMDLVDDVKDLLDTLGISNAILIG KDFGAIPAYLVAAVHPEKVASVITLGVPFILPGPSAVQNHLLPKGFYITR WQEPGRAETDFGRFDVKSVIRNIYTLFSKSEVPVAGDEQEIMDLFNPSTP LPPWFSEEDLTAYASQYEKSGFRFALQVPYRSLTVESGLIDPKVNVPALL IMGEKDYCFNFPGMEDYIRGGVAKNFVPKLETIYIPEGSHFVHEQFPEQV NKLIIEFLDKQSI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MENIQHSHVEVKGLKLHVAEIGTGEKVVVFLHGFPEIWYTWRYQMIAVAN
AGYRAIAFDFGGYGLSDHPAEPEKATIMDLVDDVKDLLDTLGISNAILIG
KDFGAIPAYLVAAVHPEKVASVITLGVPFILPGPSAVQNHLLPKGFYITR
WQEPGRAETDFGRFDVKSVIRNIYTLFSKSEVPVAGDEQEIMDLFNPSTP
LPPWFSEEDLTAYASQYEKSGFRFALQVPYRSLTVESGLIDPKVNVPALL
IMGEKDYCFNFPGMEDYIRGGVAKNFVPKLETIYIPEGSHFVHEQFPEQV
NKLIIEFLDKQSI

No Reference

Send your questions or comments to :Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.

For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page

webmaster

Acknowledgements and disclaimer