Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: melin-ACHE2

Meloidogyne incognita acetylcholinesterase mRNA, complete cds

Comment
18 non synonymous amino acid differences in ace2 were found in the fosthiazate resistance strain of Melidgyne incognita Huang et al. 2016


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Meloidogyne incognita
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Nematoda: N E > Chromadorea: N E > Tylenchida: N E > Tylenchina: N E > Tylenchoidea: N E > Meloidogynidae: N E > Meloidogyninae: N E > Meloidogyne: N E > Meloidogyne incognita group: N E > Meloidogyne incognita: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AF495588, KU360593, KU366259
1 Ncbi-nid : 33321853
1 Ncbi-pid : 33321854
3 UniProt : Q71JB7, A0A173G6E9, A0A173G6F1
3 Interpro : Q71JB7, A0A173G6E9, A0A173G6F1
3 Prodom : Q71JB7, A0A173G6E9, A0A173G6F1
3 Pfam : Q71JB7, A0A173G6E9, A0A173G6F1
3 PIRSF : Q71JB7, A0A173G6E9, A0A173G6F1
3 SUPERFAM : Q71JB7, A0A173G6E9, A0A173G6F1
Sequence
Graphical view for this peptide sequence: melin-ACHE2
Colored MSA for ACHE (raw)
MRKRRRKTTAFSINTSELLRLYFKFSSHSCLTFIFCCFFCLIVYCSSVHG
RSSPVALTDVLIQTTLGKIIGFKQKFDGKSVHTFLGVPYAKSPTGSGRFG
LPEMIEPWEGEFRADKPARTCFFSRDTMFPDFPGAEMWNPPNDIDEDCLA
MNIWVPEHHDGTVLVWIYGGGFYSGSPSLDLYDGRVLAVQERAVVININY
RLGPFGFLYFGDDTSVPGNMGLQDQQMALKWIHEHIAHFGGDPRRVTLFG
ESAGSASAMAHMFADGSYSLFSRIIAQSGSIINNWATKPKASILQISLQL
AHHLNCSNGNNSTKAMQNIVECIRRVPTSIIQRAGDAVSQSLSLPMDFAF
VPIDEDTHFFRGNVFDKLRRKNFKRDVSILVGTVRDEGTYWLPYCLQKNG
FGFNHTISPEDHINQALISETDYSKAFDAFLPYFGNSNLVRHALMHAYSH
LPTEKQEQRWRDGVARFLGDYFFTCDSIEFADIVSDELYGSVYSFYFTRR
SSANPWPQWMGAMHGYEIEYVFGLPLRSPHLYDPSELELEISFSTKIMEF
WGHFARTGEPVEFWPKYNRITRKSLVLSEEIATGTSHRIYVDVHGKLCRL
LEEAQAVAGITGEQRSRICPDGRATTVNYGQEISMEDVKEEMQLNRGISG
INRIPSIKIYISLIILSLALLRSPEISFLYSSFIFK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRKRRRKTTAFSINTSELLRLYFKFSSHSCLTFIFCCFFCLIVYCSSVHG
RSSPVALTDVLIQTTLGKIIGFKQKFDGKSVHTFLGVPYAKSPTGSGRFG
LPEMIEPWEGEFRADKPARTCFFSRDTMFPDFPGAEMWNPPNDIDEDCLA
MNIWVPEHHDGTVLVWIYGGGFYSGSPSLDLYDGRVLAVQERAVVININY
RLGPFGFLYFGDDTSVPGNMGLQDQQMALKWIHEHIAHFGGDPRRVTLFG
ESAGSASAMAHMFADGSYSLFSRIIAQSGSIINNWATKPKASILQISLQL
AHHLNCSNGNNSTKAMQNIVECIRRVPTSIIQRAGDAVSQSLSLPMDFAF
VPIDEDTHFFRGNVFDKLRRKNFKRDVSILVGTVRDEGTYWLPYCLQKNG
FGFNHTISPEDHINQALISETDYSKAFDAFLPYFGNSNLVRHALMHAYSH
LPTEKQEQRWRDGVARFLGDYFFTCDSIEFADIVSDELYGSVYSFYFTRR
SSANPWPQWMGAMHGYEIEYVFGLPLRSPHLYDPSELELEISFSTKIMEF
WGHFARTGEPVEFWPKYNRITRKSLVLSEEIATGTSHRIYVDVHGKLCRL
LEEAQAVAGITGEQRSRICPDGRATTVNYGQEISMEDVKEEMQLNRGISG
INRIPSIKIYISLIILSLALLRSPEISFLYSSFIFK


References
    Title: Expression and evolutionary analyses of three acetylcholinesterase genes (Mi-ace-1, Mi-ace-2, Mi-ace-3) in the root-knot nematode Meloidogyne incognita
    Cui R, Zhang L, Chen Y, Huang W, Fan C, Wu Q, Peng D, da Silva W, Sun X
    Ref: Experimental Parasitology, 176:75, 2017 : PubMed

            

    Title: Mutations in Acetylcholinesterase2 (ace2) increase the insensitivity of acetylcholinesterase to fosthiazate in the root-knot nematode Meloidogyne incognita
    Huang WK, Wu QS, Peng H, Kong LA, Liu SM, Yin HQ, Cui RQ, Zhan LP, Cui JK, Peng DL
    Ref: Sci Rep, 6:38102, 2016 : PubMed

            

    Title: Molecular cloning and life stage expression pattern of a new acetylcholinesterase gene from the plant parasitic nematode Meloidogyne incognita.
    Laffaire JB, Jaubert S, Abad P, Rosso MN
    Ref: Nematology, 5:213, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer