Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mellp-f4sav3

Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7) (Poplar leaf rust fungus) Putative uncharacterized protein

Relationship
Family|Canar_LipB
Block| L
Position in NCBI Life Tree|Melampsora larici-populina
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Pucciniomycotina: N E > Pucciniomycetes: N E > Pucciniales: N E > Melampsoraceae: N E > Melampsora: N E > Melampsora larici-populina: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GL883181
1 UniProt : F4SAV3
1 UniProt : F4SAV3
1 Interpro : F4SAV3
1 Pfam : F4SAV3
1 PIRSF : F4SAV3
1 SUPERFAM : F4SAV3
Sequence
Graphical view for this peptide sequence: mellp-f4sav3
Colored MSA for Canar_LipB (raw)
MMYKDFLLVFVAFDLNRWNNEGAPGDAPFSQGELSYQNAIHCPHGIRNLE
RGIVLLVPCTSCEATEVFAETPIALRLPQEGFDVCWVNLPFHGLGDMQLS
GEFVAFAVNYLAEKSVSGKINVVTYSQGGSNAQWAITFWPSIRNQIINFI
TLAAPHKGTLLTRPICTSLNLLGGCLTSVLQMDRNSRYMNAVNNISSVND
GKQALVPTTSVYTLIDEIVTPQASNPEGASYVTGASNIAIQDACSKAHVV
EHFGLIFDLATYGLVYDALIHGRPASLRTFDRKYCEKHYKNLAHFALELP
LDIQATWRTLFGNFFDRLNMIKRTLTSFRVPAEPLLMVQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMYKDFLLVFVAFDLNRWNNEGAPGDAPFSQGELSYQNAIHCPHGIRNLE
RGIVLLVPCTSCEATEVFAETPIALRLPQEGFDVCWVNLPFHGLGDMQLS
GEFVAFAVNYLAEKSVSGKINVVTYSQGGSNAQWAITFWPSIRNQIINFI
TLAAPHKGTLLTRPICTSLNLLGGCLTSVLQMDRNSRYMNAVNNISSVND
GKQALVPTTSVYTLIDEIVTPQASNPEGASYVTGASNIAIQDACSKAHVV
EHFGLIFDLATYGLVYDALIHGRPASLRTFDRKYCEKHYKNLAHFALELP
LDIQATWRTLFGNFFDRLNMIKRTLTSFRVPAEPLLMVQ


Reference
    Title: Obligate biotrophy features unraveled by the genomic analysis of rust fungi
    Duplessis S, Cuomo CA, Lin YC, Aerts A, Tisserant E, Veneault-Fourrey C, Joly DL, Hacquard S, Amselem J and Martin F <40 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 108:9166, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer