Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: metaq-e9edt7

Metarhizium acridum (strain CQMa 102). Putative histone deacetylase A

Comment
A fragment A0A1Y1LLH0 found in Photinus pyralis (Common eastern firefly) (Lampyris pyralis) probably a contaminent


Relationship
Family|Arb2_domain
Block| X
Position in NCBI Life Tree|Metarhizium acridum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Clavicipitaceae: N E > Metarhizium: N E > Metarhizium acridum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : GL698562, XP_007814382.1, GEZM01052341
2 UniProt : E9EDT7, A0A1Y1LLH0
2 UniProt : E9EDT7, A0A1Y1LLH0
2 Interpro : E9EDT7, A0A1Y1LLH0
2 Prodom : E9EDT7, A0A1Y1LLH0
2 Pfam : E9EDT7, A0A1Y1LLH0
2 PIRSF : E9EDT7, A0A1Y1LLH0
2 SUPERFAM : E9EDT7, A0A1Y1LLH0
Sequence
Graphical view for this peptide sequence: metaq-e9edt7
Colored MSA for Arb2_domain (raw)
RLHDVIRSAQRLVLQEKHNMIPLYVQRDQLYKSFENQVLVTPNLHNSRRM
LVIIHDPPQLLAQPDPIDSSLQPHNAWVVDGVTRYIDWAISQKFGIMDIN
VPAYITNDEDTDSYIPGYRERILQEQVQQLMNYLWDNFLQLYDADEIFLM
GVGNAYLGVKVLLINRDCKSKLSGVVNFVTGNLRPVKSDIDPDLSLWYKE
NSRVYVAGDHACWSDHDLTKKVQKRRFGTVIRSPKLGLNKMMQEHADEVQ
GWILSRVSATSRGDTTEEEDEDDGNGIGGVRAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RLHDVIRSAQRLVLQEKHNMIPLYVQRDQLYKSFENQVLVTPNLHNSRRM
LVIIHDPPQLLAQPDPIDSSLQPHNAWVVDGVTRYIDWAISQKFGIMDIN
VPAYITNDEDTDSYIPGYRERILQEQVQQLMNYLWDNFLQLYDADEIFLM
GVGNAYLGVKVLLINRDCKSKLSGVVNFVTGNLRPVKSDIDPDLSLWYKE
NSRVYVAGDHACWSDHDLTKKVQKRRFGTVIRSPKLGLNKMMQEHADEVQ
GWILSRVSATSRGDTTEEEDEDDGNGIGGVRAG


References
    Title: Molecular characterization of firefly nuptial gifts: a multi-omics approach sheds light on postcopulatory sexual selection
    Al-Wathiqui N, Fallon TR, South A, Weng JK, Lewis SM
    Ref: Sci Rep, 6:38556, 2016 : PubMed

            

    Title: Genome sequencing and comparative transcriptomics of the model entomopathogenic fungi Metarhizium anisopliae and M. acridum
    Gao Q, Jin K, Ying SH, Zhang Y, Xiao G, Shang Y, Duan Z, Hu X, Xie XQ and Wang C <14 more author(s)>
    Ref: PLoS Genet, 7:e1001264, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer