Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: meti4-b3dx04

Methylacidiphilum infernorum (isolate V4) (Methylokorus infernorum (strain V4))Alpha/beta superfamily hydrolase

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Methylacidiphilum infernorum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > PVC group: N E > Verrucomicrobia: N E > Methylacidiphilae: N E > Methylacidiphilales: N E > Methylacidiphilaceae: N E > Methylacidiphilum: N E > Methylacidiphilum infernorum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000975
1 UniProt : B3DX04
1 UniProt : B3DX04
1 Interpro : B3DX04
1 Prodom : B3DX04
1 Pfam : B3DX04
1 PIRSF : B3DX04
1 SUPERFAM : B3DX04
Sequence
Graphical view for this peptide sequence: meti4-b3dx04
Colored MSA for AlphaBeta_hydrolase (raw)
MNHSIPSEIRNAHGERLDFIYTPGSADNNTLIIIAHGITAHKDRPMLVTL
TNYLAKNGIHSLRFSFSGHGKSEGKFEEFTPTKEVGDLQSVFNALPGWTK
YGYVGHSLGAAVGVLFASQDPRVSFLISLAGMAYTAAFAEREFGTVTPGQ
GYMWDMPEFPLSKVLIEDMNRIDNVKEAAKKIKLPWLFIHGLADDVVPPQ
DSRDLFAIASGPKKLVEIPGCDHLFPPPHDSFMAETVVNWLKELQLIS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNHSIPSEIRNAHGERLDFIYTPGSADNNTLIIIAHGITAHKDRPMLVTL
TNYLAKNGIHSLRFSFSGHGKSEGKFEEFTPTKEVGDLQSVFNALPGWTK
YGYVGHSLGAAVGVLFASQDPRVSFLISLAGMAYTAAFAEREFGTVTPGQ
GYMWDMPEFPLSKVLIEDMNRIDNVKEAAKKIKLPWLFIHGLADDVVPPQ
DSRDLFAIASGPKKLVEIPGCDHLFPPPHDSFMAETVVNWLKELQLIS


Reference
    Title: Complete genome sequence of the extremely acidophilic methanotroph isolate V4, Methylacidiphilum infernorum, a representative of the bacterial phylum Verrucomicrobia
    Hou S, Makarova KS, Saw JH, Senin P, Ly BV, Zhou Z, Ren Y, Wang J, Galperin MY and Alam M <11 more author(s)>
    Ref: Biol Direct, 3:26, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer