Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: metma-MM3198

Methanosarcina mazei (Methanosarcina frisia) hypothetical protein mm3198

Comment
only c-term a/b hydrolase


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Methanosarcina mazei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > Euryarchaeota: N E > Methanomicrobia: N E > Methanosarcinales: N E > Methanosarcinaceae: N E > Methanosarcina: N E > Methanosarcina mazei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: metma-MM3198
Colored MSA for 6_AlphaBeta_hydrolase (raw)
REQDPVRPYPYDEEEVVYENEGAGVKLAGTLTLPRSEGPFPAVILISGSG
QQNRDEELLGHRPFLVLSDYLTQRGIAVLRVDDRGTGGSTGDFSQATSED
FAGDVLAGIDYLKSREEIDPTQIGLIGHSEGGLIAPIVAVESRDVAFIVL
MAGPGITGEEILYLQSELISRAEGVDNETIARNNALMKSIYSAIKEEQND
EIAAEKLRKLMMDEMANMSEEEKQSAGYSEADLDAQIQSLLSPWMRNFLT
YDPRPTLIKVKCPVLAINGEKDLQVPPEENLQAIEEALEAGGNQDYTVKE
LPGLNHLFQTSQTGSPSEYARIEETISPTALELIGDWISERTSAAVEKQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

REQDPVRPYPYDEEEVVYENEGAGVKLAGTLTLPRSEGPFPAVILISGSG
QQNRDEELLGHRPFLVLSDYLTQRGIAVLRVDDRGTGGSTGDFSQATSED
FAGDVLAGIDYLKSREEIDPTQIGLIGHSEGGLIAPIVAVESRDVAFIVL
MAGPGITGEEILYLQSELISRAEGVDNETIARNNALMKSIYSAIKEEQND
EIAAEKLRKLMMDEMANMSEEEKQSAGYSEADLDAQIQSLLSPWMRNFLT
YDPRPTLIKVKCPVLAINGEKDLQVPPEENLQAIEEALEAGGNQDYTVKE
LPGLNHLFQTSQTGSPSEYARIEETISPTALELIGDWISERTSAAVEKQ



Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer