Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: metsb-b8eq01

Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906). Magnesium chelatase accessory protein

Relationship
Family|Mg-chelatase_BchO
Block| X
Position in NCBI Life Tree|Methylocella silvestris
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Beijerinckiaceae: N E > Methylocella: N E > Methylocella silvestris: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP001280
1 UniProt : B8EQ01
1 UniProt : B8EQ01
1 Interpro : B8EQ01
1 Prodom : B8EQ01
1 Pfam : B8EQ01
1 PIRSF : B8EQ01
1 SUPERFAM : B8EQ01
Sequence
Graphical view for this peptide sequence: metsb-b8eq01
Colored MSA for Mg-chelatase_BchO (raw)
MSDRLDWDKDGADWPNRATSRFVTAGELRWHVQIMGDGPVLLLLHGAGSS
THSWRDLAPLLARRFTIVAPDLPGHGFTQAPRPRDMSTDGMAKAVSSLVA
ALDVDPTYAAGHSAGAAILCRMRLERAIEPRLLFSLNGALLPFDGFAGRV
FSPLAKMMFKNTLIPAPRLFAWLASDRSSVERTLRNVGAHLDRRGVEFYA
RLFRNAGHVGATLGMMAHWDLKSLRRDLPRLDSHLVLVATEDDRAIPVRD
AHAAAGLVPGSRKIILRRGGHLLHEERPEEAFDLIVAAIEQYQAGSASLA
PSVFPPAPPARHVGGVGKSARGQKNPHPAPPQAGQGGAQCEDQAKAGQEV
QQEAPAAGPPVQKKKRRLARHQDQDQIGEAPARK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSDRLDWDKDGADWPNRATSRFVTAGELRWHVQIMGDGPVLLLLHGAGSS
THSWRDLAPLLARRFTIVAPDLPGHGFTQAPRPRDMSTDGMAKAVSSLVA
ALDVDPTYAAGHSAGAAILCRMRLERAIEPRLLFSLNGALLPFDGFAGRV
FSPLAKMMFKNTLIPAPRLFAWLASDRSSVERTLRNVGAHLDRRGVEFYA
RLFRNAGHVGATLGMMAHWDLKSLRRDLPRLDSHLVLVATEDDRAIPVRD
AHAAAGLVPGSRKIILRRGGHLLHEERPEEAFDLIVAAIEQYQAGSASLA
PSVFPPAPPARHVGGVGKSARGQKNPHPAPPQAGQGGAQCEDQAKAGQEV
QQEAPAAGPPVQKKKRRLARHQDQDQIGEAPARK


Reference
    Title: Complete genome sequence of the aerobic facultative methanotroph Methylocella silvestris BL2
    Chen Y, Crombie A, Rahman MT, Dedysh SN, Liesack W, Stott MB, Alam M, Theisen AR, Murrell JC, Dunfield PF
    Ref: Journal of Bacteriology, 192:3840, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer