Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mizye-a0a210pij5

Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). Alpha/beta hydrolase domain-containing protein 13

Relationship
Family|ABHD13-BEM46
Block| X
Position in NCBI Life Tree|Mizuhopecten yessoensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Lophotrochozoa: N E > Mollusca: N E > Bivalvia: N E > Pteriomorphia: N E > Pectinoida: N E > Pectinoidea: N E > Pectinidae: N E > Mizuhopecten: N E > Mizuhopecten yessoensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : NEDP02076642
1 UniProt : A0A210PIJ5
1 UniProt : A0A210PIJ5
1 Interpro : A0A210PIJ5
1 Prodom : A0A210PIJ5
1 Pfam : A0A210PIJ5
1 PIRSF : A0A210PIJ5
1 SUPERFAM : A0A210PIJ5
Sequence
Graphical view for this peptide sequence: mizye-a0a210pij5
Colored MSA for ABHD13-BEM46 (raw)
MTENVDIGSANRIAESELDTNSPEMGKGFRTIEWVTRLIFAVVMRFWKLC
TSAALILLLAFWTTGGVVTFLLLIFALIGLFYNAQDMLLYYPDQPPQSRL
FVQLPNTINLPYENHFIRTSDNVRINVVLIKHTHANAPTVIYFHGNAGNI
GHRLVNSHGFFTSCGVNVLLVEYRGYGKSEGSPSETGLYRDAEAAINFLL
GRNDINSEKIVVFGRSLGGAVAVWLAAQPFYAQHIAALVVENTFTSLPEI
GRTIFNFKLMELLPQILFKHKYPSAERIKKIKLPTLFLSGQADDLIPPKM
MTKLHQVSGSGMKRIHRFDQGTHNETWMCSGYYEAFLQFLKDVILAKSVS
QAQEQSRPIVNNFSSNPNLTQV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTENVDIGSANRIAESELDTNSPEMGKGFRTIEWVTRLIFAVVMRFWKLC
TSAALILLLAFWTTGGVVTFLLLIFALIGLFYNAQDMLLYYPDQPPQSRL
FVQLPNTINLPYENHFIRTSDNVRINVVLIKHTHANAPTVIYFHGNAGNI
GHRLVNSHGFFTSCGVNVLLVEYRGYGKSEGSPSETGLYRDAEAAINFLL
GRNDINSEKIVVFGRSLGGAVAVWLAAQPFYAQHIAALVVENTFTSLPEI
GRTIFNFKLMELLPQILFKHKYPSAERIKKIKLPTLFLSGQADDLIPPKM
MTKLHQVSGSGMKRIHRFDQGTHNETWMCSGYYEAFLQFLKDVILAKSVS
QAQEQSRPIVNNFSSNPNLTQV


Reference
    Title: Scallop genome provides insights into evolution of bilaterian karyotype and development
    Wang S, Zhang J, Jiao W, Li J, Xun X, Sun Y, Guo X, Huan P, Dong B and Bao Z <42 more author(s)>
    Ref: Nat Ecol Evol, 1:120, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer