Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mizye-a0a210ptr6

Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). Carboxylic ester hydrolase PYE-110997.15

Relationship
Family|Carb_B_Mollusca
Block| C
Position in NCBI Life Tree|Mizuhopecten yessoensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Lophotrochozoa: N E > Mollusca: N E > Bivalvia: N E > Pteriomorphia: N E > Pectinoida: N E > Pectinoidea: N E > Pectinidae: N E > Mizuhopecten: N E > Mizuhopecten yessoensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : NEDP02005500
1 UniProt : A0A210PTR6
1 UniProt : A0A210PTR6
1 Interpro : A0A210PTR6
1 Pfam : A0A210PTR6
1 PIRSF : A0A210PTR6
1 SUPERFAM : A0A210PTR6
Sequence
Graphical view for this peptide sequence: mizye-a0a210ptr6
Colored MSA for Carb_B_Mollusca (raw)
MMQAVVQIFVTFGLVVGITGQNTKVITTPSGQLRGLVTLANNSIVYQFRN
IPYAKPPIGELRFAKPVEYGSWPGIRDATAFGPACTQSVNGVTYQNVSED
CLTLNVYVPKNMLGNRTVMVWIHGGGYIKGEAAIFDGSYLALRGGLVVVT
INYRLGVFGFLSTNDTVIPGNNGLWDQQLALKWLKTNIKAFGGNSESVTI
FGESAGGFSVGLQSIIPQNKGLFHRAIAQSGAAPSFLTIVHQPLLFTVSF
GERVGCHFITSNSPMFLKCLKSKTAKELLNAQINASAPVSLTPFSFGPVI
SPVVDKEFLPDVPSALMKNKSSESYQFFRTLDFMAGNVNREGSIFINKYL
YNFSQIFHFVPEKGVPNAVVCNVLAPGAVSAFSKSIVKNKTIEKEICDEY
KDDDPELEGNKMGDLFGDAFFVVPSVVALDVHSDGNNMTNTFQYIFNRRN
PAMRGNGPYPHWFTGAPHASDNVFLFGIQQLAQRIHVSDADLNLSAHMQQ
YWANFAKTGKPFADGSANWPYYDRTSRSYLNLDDVISAKEHIFLDRVTFW
TEKVPIF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMQAVVQIFVTFGLVVGITGQNTKVITTPSGQLRGLVTLANNSIVYQFRN
IPYAKPPIGELRFAKPVEYGSWPGIRDATAFGPACTQSVNGVTYQNVSED
CLTLNVYVPKNMLGNRTVMVWIHGGGYIKGEAAIFDGSYLALRGGLVVVT
INYRLGVFGFLSTNDTVIPGNNGLWDQQLALKWLKTNIKAFGGNSESVTI
FGESAGGFSVGLQSIIPQNKGLFHRAIAQSGAAPSFLTIVHQPLLFTVSF
GERVGCHFITSNSPMFLKCLKSKTAKELLNAQINASAPVSLTPFSFGPVI
SPVVDKEFLPDVPSALMKNKSSESYQFFRTLDFMAGNVNREGSIFINKYL
YNFSQIFHFVPEKGVPNAVVCNVLAPGAVSAFSKSIVKNKTIEKEICDEY
KDDDPELEGNKMGDLFGDAFFVVPSVVALDVHSDGNNMTNTFQYIFNRRN
PAMRGNGPYPHWFTGAPHASDNVFLFGIQQLAQRIHVSDADLNLSAHMQQ
YWANFAKTGKPFADGSANWPYYDRTSRSYLNLDDVISAKEHIFLDRVTFW
TEKVPIF


References
    Title: Identification, characterization and expression analyses of cholinesterases genes in Yesso scallop (Patinopecten yessoensis) reveal molecular function allocation in responses to ocean acidification
    Xing Q, Liao H, Peng C, Zheng G, Yang Z, Wang J, Lu W, Huang X, Bao Z
    Ref: Aquat Toxicol, 231:105736, 2020 : PubMed

            

    Title: Scallop genome provides insights into evolution of bilaterian karyotype and development
    Wang S, Zhang J, Jiao W, Li J, Xun X, Sun Y, Guo X, Huan P, Dong B and Bao Z <42 more author(s)>
    Ref: Nat Ecol Evol, 1:120, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer