mondo-d2x2i9

 
Monodelphis domestica (Short-tailed gray opossum) Neuroligin 4

Relationship
Family Neuroligin
Block C
Monodelphis domestica position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Metatheria: N E > Didelphimorphia: N E > Didelphidae: N E > Didelphinae: N E > Monodelphis: N E > Monodelphis domestica: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : GQ489220
1 UniProt : D2X2I9
1 UniProtTrembl : D2X2I9
1 Interpro : D2X2I9
1 Prodom : D2X2I9
1 Pfam : D2X2I9
1 PIRSF : D2X2I9
1 SUPERFAM : D2X2I9
1 QuickSwissBlast : D2X2I9
 
Sequence
Graphical view for this peptide sequence: mondo-d2x2i9
Colored MSA for Neuroligin (raw)
MLNSNFLLWITALAIRFTLIDSQAQYPVVTTNYGKIRGLRTPLPNEILGP
VEQYLGVPYASPPTGERRFQPPEPPSSWTGVRNATQFAAVCPQHLDERSL
LHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDGANTKKSADDIT
SNDRGEDEDIHDQNSRKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVI
TLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWIEENIGSFGGDPKRVT
IFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRI
LADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVI
PDDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVSPNDFDFSV
SNFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQW
VAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGI
PMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHT
KPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHN
LNEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKH
SKDPHKTNPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYK
KDKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAH
DTLRLTCPPDYTLTLRRSPDDIPLMTPNTITMIPNTLTGMQPLHTFNTFS
GGQNSTNLPHGHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLNSNFLLWITALAIRFTLIDSQAQYPVVTTNYGKIRGLRTPLPNEILGP
VEQYLGVPYASPPTGERRFQPPEPPSSWTGVRNATQFAAVCPQHLDERSL
LHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDGANTKKSADDIT
SNDRGEDEDIHDQNSRKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVI
TLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWIEENIGSFGGDPKRVT
IFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRI
LADKVGCNMLDTTDMVECLRNKNYKELIQQTITPATYHIAFGPVIDGDVI
PDDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVSPNDFDFSV
SNFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQW
VAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGI
PMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHT
KPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHN
LNEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKH
SKDPHKTNPEDTTVLIETKRDYSTELSVTIAVGASLLFLNILAFAALYYK
KDKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAH
DTLRLTCPPDYTLTLRRSPDDIPLMTPNTITMIPNTLTGMQPLHTFNTFS
GGQNSTNLPHGHSTTRV

no DNA




Reference
    Title: Characterization of the neuroligin gene family expression and evolution in zebrafish
    Rissone A, Sangiorgio L, Monopoli M, Beltrame M, Zucchi I, Bussolino F, Arese M, Cotelli F
    Ref: Developmental Dynamics, 239:688, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer