Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-1hlip

Mus musculus (Mouse), Mus spretus (Western Mediterranean mouse) (Algerian mouse) hepatic triacylglycerol lipase

Comment
Trembl Q8VC44 1aa diff with P27656 Trembl Q80Z65 AY225159 is for Mus spretus (Western wild mouse).Hepatic lipase (Farahani et al.) 5 aa diff from mouse-1hlip


Relationship
Family|Hepatic_Lipase
Block| L
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: X58426, AY225159, AK158360
>3 UniProt links 1 more: P27656, Q80Z65, Q3TYU0
2 Ncbi-nid : 51467, 51468
>3 UniProt links 1 more: P27656, Q80Z65, Q3TYU0
>3 Interpro links 1 more: P27656, Q80Z65, Q3TYU0
>3 Prodom links 1 more: P27656, Q80Z65, Q3TYU0
>3 Pfam links 1 more: P27656, Q80Z65, Q3TYU0
>3 PIRSF links 1 more: P27656, Q80Z65, Q3TYU0
>3 SUPERFAM links 1 more: P27656, Q80Z65, Q3TYU0
1 MGD : 96216
2 ENSEMBL : P27656, ENSMUSG00000032207
Sequence
Graphical view for this peptide sequence: mouse-1hlip
Colored MSA for Hepatic_Lipase (raw)
MGNPLQISIFLVFCIFIQSSACGQGVGTEPFGRSLGATEASKPLKKPETR
FLLFQDENDRLGCRLRPQHPETLQECGFNSSQPLIMIIHGWSVDGLLENW
IWKIVSALKSRQSQPVNVGLVDWISLAYQHYTIAVQNTRIVGQDVAALLL
WLEESAKFSRSKVHLIGYSLGAHVSGFAGSSMDGKNKIGRITGLDPAGPM
FEGTSPNERLSPDDANFVDAIHTFTREHMGLSVGIKQPIAHYDFYPNGGS
FQPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHPFIDSLQHSDLQSIG
FQCSDMGSFSQGLCLSCKKGRCNTLGYDIRKDRSGKSKRLFLITRAQSPF
KVYHYQFKIQFINQIEKPVEPTFTMSLLGTKEEIKRIPITLGEGITSNKT
YSFLITLDKDIGELILLKFKWENSAVWANVWNTVQTIMLWGIEPHHSGLI
LKTIWVKAGETQQRMTFCPENLDDLQLHPSQEKVFVNCEVKSKRLTESKE
QMSQETHAKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGNPLQISIFLVFCIFIQSSACGQGVGTEPFGRSLGATEASKPLKKPETR
FLLFQDENDRLGCRLRPQHPETLQECGFNSSQPLIMIIHGWSVDGLLENW
IWKIVSALKSRQSQPVNVGLVDWISLAYQHYTIAVQNTRIVGQDVAALLL
WLEESAKFSRSKVHLIGYSLGAHVSGFAGSSMDGKNKIGRITGLDPAGPM
FEGTSPNERLSPDDANFVDAIHTFTREHMGLSVGIKQPIAHYDFYPNGGS
FQPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHPFIDSLQHSDLQSIG
FQCSDMGSFSQGLCLSCKKGRCNTLGYDIRKDRSGKSKRLFLITRAQSPF
KVYHYQFKIQFINQIEKPVEPTFTMSLLGTKEEIKRIPITLGEGITSNKT
YSFLITLDKDIGELILLKFKWENSAVWANVWNTVQTIMLWGIEPHHSGLI
LKTIWVKAGETQQRMTFCPENLDDLQLHPSQEKVFVNCEVKSKRLTESKE
QMSQETHAKK


References
1 more
    Title: Reciprocal hemizygosity analysis of mouse hepatic lipase reveals influence on obesity
    Farahani P, Fisler JS, Wong H, Diament AL, Yi N, Warden CH
    Ref: Obes Res, 12:292, 2004 : PubMed

            

    Title: Characterization of cDNA encoding the mouse hepatic triglyceride lipase and expression by in vitro translation
    Chang SF, Netter HJ, Will H
    Ref: FEBS Letters, 289:69, 1991 : PubMed

            

    Title: Molecular cloning of mouse hepatic triacylglycerol lipase: gene expression in combined lipase-deficient (cld/cld) mice
    Oka K, Nakano T, Tkalcevic GT, Scow RO, Brown WV
    Ref: Biochimica & Biophysica Acta, 1089:13, 1991 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer