Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-1llip

Mus musculus (C57 Black/6X CBA) LAL mRNA for lysosomal acid lipase

Comment
Q8C2G7 from Okazaki differs by 4 aa Q6PDR1 Q9Z0M5 some differences


Relationship
Family|Acidic_Lipase
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : Z31689, BC058564, AK169567
3 UniProt : Q6PDR1, Q9Z0M5, Q3TEL5
1 Ncbi-nid : 4456670
1 Ncbi-pid : 4456671
3 UniProt : Q6PDR1, Q9Z0M5, Q3TEL5
3 Interpro : Q6PDR1, Q9Z0M5, Q3TEL5
3 Prodom : Q6PDR1, Q9Z0M5, Q3TEL5
3 Pfam : Q6PDR1, Q9Z0M5, Q3TEL5
3 PIRSF : Q6PDR1, Q9Z0M5, Q3TEL5
3 SUPERFAM : Q6PDR1, Q9Z0M5, Q3TEL5
1 MGD : 96789
2 ENSEMBL : Q9Z0M5, ENSMUSG00000024781
Sequence
Graphical view for this peptide sequence: mouse-1llip
Colored MSA for Acidic_Lipase (raw)
MQLQGLVFVFTIGILLSRVPTGTVSAVDPEVNMNVTEIIMRWGYPGEEHS
VLTGDGYILSIHRIPRGWKNHFGKGPRPVVYLQHGLLADSSNWVTNIDNS
SLGFLLADRGFDVWMGNSRGNTWSLKHKTLSVSQDEFWAFSFDEMAKYDL
PASINYILNKTGQEQIYYVGHSQGCTIGFIAFSQMPELAKKIKMFLVLAP
VLSLNFASGPLLQLGRLPDPLLKDMFGQKQFLPQSAMLKWLSIHVCTHVI
MKELCANVFFLLCGFNEKNLNMSRVDVYTTHCPAELLVQNMLHWGQVFKY
RKLQAFDWGSSEKNYFHYNQSFPPSYNIKNMRLPTALWSGGRDWLADIND
ITILLTQIPKLVYHKNIPEWDHLDFIWGLDAPWKLYDEIISLMKKYQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQLQGLVFVFTIGILLSRVPTGTVSAVDPEVNMNVTEIIMRWGYPGEEHS
VLTGDGYILSIHRIPRGWKNHFGKGPRPVVYLQHGLLADSSNWVTNIDNS
SLGFLLADRGFDVWMGNSRGNTWSLKHKTLSVSQDEFWAFSFDEMAKYDL
PASINYILNKTGQEQIYYVGHSQGCTIGFIAFSQMPELAKKIKMFLVLAP
VLSLNFASGPLLQLGRLPDPLLKDMFGQKQFLPQSAMLKWLSIHVCTHVI
MKELCANVFFLLCGFNEKNLNMSRVDVYTTHCPAELLVQNMLHWGQVFKY
RKLQAFDWGSSEKNYFHYNQSFPPSYNIKNMRLPTALWSGGRDWLADIND
ITILLTQIPKLVYHKNIPEWDHLDFIWGLDAPWKLYDEIISLMKKYQ


References
18 more
    Title: Loss of Function of Lysosomal Acid Lipase (LAL) Profoundly Impacts Osteoblastogenesis and Increases Fracture Risk in Humans
    Helderman RC, Whitney DG, Duta-Mare M, Akhmetshina A, Vujic N, Jayapalan S, Nyman JS, Misra BB, Rosen CJ and Rendina-Ruedy E <2 more author(s)>
    Ref: Bone, :115946, 2021 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            

    Title: Tissue and cellular specific expression of murine lysosomal acid lipase mRNA and protein
    Du H, Witte DP, Grabowski GA
    Ref: J Lipid Res, 37:937, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer