mouse-1plip

 
Mus musculus RIKEN Pancreatic lipase

Relationship
Block L
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : AK007357, BC061061, AY387690
1 UniProt : Q6P8U6
1 Ncbi-nid : 12840854
1 Ncbi-pid : 12840855
2 UniProtTrembl : Q9D950, Q6P8U6
2 Interpro : Q9D950, Q6P8U6
2 Prodom : Q9D950, Q6P8U6
2 Pfam : Q9D950, Q6P8U6
2 PIRSF : Q9D950, Q6P8U6
2 SUPERFAM : Q9D950, Q6P8U6
2 QuickSwissBlast : Q9D950, Q6P8U6
1 MGD : 1916310
2 ENSEMBL : Q9D950, ENSMUSG00000046008
 
Sequence
Graphical view for this peptide sequence: mouse-1plip
Colored MSA for Pancreatic_lipase (raw)
MLMLWTFAVLLGAVAGREVCFDKLGCFSDDAPWSGTLDRPLKALPWSPAQ
INTRFLLYTNENPDNYQLITSDASNIRNSNFRTNRKTRIIIHGFIDKGEE
NWLSDMCKNMFRVESVNCICVDWKGGSRTTYTQATQNVRVVGAEVALLVN
VLQSDLGYSLNNVHLIGHSLGSHIAGEAGKRTFGAIGRITGLDPAEPYFQ
GTPEEVRLDPTDAQFVDAIHTDAGPIIPNLGFGMSQTVGHLDFFPNGGIE
MPGCQKNILSQIVDIDGIWEGTRNFAACNHLRSYKFYTDSIVNPTGFAGF
SCSSYSLFTANKCFPCGSGGCPQMGHYADRYPGKTSRLYQTFYLNTGDKS
NFARWRYQVTVTLSGQKVTGHILVSLFGNGGNSKQYEVFKGSLQPGTSHV
NEFDSDVDVGDLQKVKFIWYNNVINPTLPKVGASRITVERNDGRVFNFCS
QETVREDVLLTLSPC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLMLWTFAVLLGAVAGREVCFDKLGCFSDDAPWSGTLDRPLKALPWSPAQ
INTRFLLYTNENPDNYQLITSDASNIRNSNFRTNRKTRIIIHGFIDKGEE
NWLSDMCKNMFRVESVNCICVDWKGGSRTTYTQATQNVRVVGAEVALLVN
VLQSDLGYSLNNVHLIGHSLGSHIAGEAGKRTFGAIGRITGLDPAEPYFQ
GTPEEVRLDPTDAQFVDAIHTDAGPIIPNLGFGMSQTVGHLDFFPNGGIE
MPGCQKNILSQIVDIDGIWEGTRNFAACNHLRSYKFYTDSIVNPTGFAGF
SCSSYSLFTANKCFPCGSGGCPQMGHYADRYPGKTSRLYQTFYLNTGDKS
NFARWRYQVTVTLSGQKVTGHILVSLFGNGGNSKQYEVFKGSLQPGTSHV
NEFDSDVDVGDLQKVKFIWYNNVINPTLPKVGASRITVERNDGRVFNFCS
QETVREDVLLTLSPC

Graphical view for this nucleotide DNA sequence (716 bp): mouse-1plip



References
1 more
    Title: Functional annotation of a full-length mouse cDNA collection
    Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y and Hayashizaki Y <86 more author(s)>
    Ref: Nature, 409:685, 2001 : PubMed

            

    Title: Normalization and subtraction of cap-trapper-selected cDNAs to prepare full-length cDNA libraries for rapid discovery of new genes
    Carninci P, Shibata Y, Hayatsu N, Sugahara Y, Shibata K, Itoh M, Konno H, Okazaki Y, Muramatsu M, Hayashizaki Y
    Ref: Genome Res, 10:1617, 2000 : PubMed

            

    Title: High-efficiency full-length cDNA cloning
    Carninci P, Hayashizaki Y
    Ref: Methods Enzymol, 303:19, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer