mouse-1plrp

 
Mus musculus (Mouse) pancreatic lipase related protein 1

Relationship
Block L
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 1 more: AF061274, BC068266, AK028105
1 UniProt : Q5BKQ4
1 Ncbi-nid : 3108174
1 Ncbi-pid : 3108175
1 UniProtTrembl : Q5BKQ4
1 Interpro : Q5BKQ4
1 Prodom : Q5BKQ4
1 Pfam : Q5BKQ4
1 PIRSF : Q5BKQ4
1 SUPERFAM : Q5BKQ4
1 QuickSwissBlast : Q5BKQ4
1 MGD : 97723
2 ENSEMBL : O70478, ENSMUSG00000042179
 
Sequence
Graphical view for this peptide sequence: mouse-1plrp
Colored MSA for Pancreatic_lipase (raw)
MLILWTIPLFLLGAAQGKEVCYDNLGCFSDAEPWAGTAIRPLKLLPWSPE
KINTRFLLYTNENPTAFQTLQLSDPSTIEASNFQVARKTRFIIHGFIDKG
EENWVVDMCKNMFQVEEVNCICVDWKRGSQTTYTQAANNVRVVGAQVAQM
IDILVRNFNYSASKVHLIGHSLGAHVAGEAGSRTPGLGRITGLDPVEANF
EGTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQMVGHFDFFPNGGQ
YMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESILNPDGFAA
YPCASYRDFESNKCFPCPDQGCPQMGHYADKFANNTSVEPQKFFLNTGEA
KNFARWRYRVSLTFSGRTVTGQVKVSLFGSNGNTRQCDIFRGIIKPGATH
SNEFDAKLDVGTIEKVKFLWNNHVVNPSFPKVGAAKITVQKGEERTEHNF
CSEETVREDILLTLLPCKTSDTM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLILWTIPLFLLGAAQGKEVCYDNLGCFSDAEPWAGTAIRPLKLLPWSPE
KINTRFLLYTNENPTAFQTLQLSDPSTIEASNFQVARKTRFIIHGFIDKG
EENWVVDMCKNMFQVEEVNCICVDWKRGSQTTYTQAANNVRVVGAQVAQM
IDILVRNFNYSASKVHLIGHSLGAHVAGEAGSRTPGLGRITGLDPVEANF
EGTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQMVGHFDFFPNGGQ
YMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESILNPDGFAA
YPCASYRDFESNKCFPCPDQGCPQMGHYADKFANNTSVEPQKFFLNTGEA
KNFARWRYRVSLTFSGRTVTGQVKVSLFGSNGNTRQCDIFRGIIKPGATH
SNEFDAKLDVGTIEKVKFLWNNHVVNPSFPKVGAAKITVQKGEERTEHNF
CSEETVREDILLTLLPCKTSDTM

Graphical view for this nucleotide DNA sequence (1666 bp): mouse-1plrp



References
3 more
    Title: Functional annotation of a full-length mouse cDNA collection
    Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y and Hayashizaki Y <86 more author(s)>
    Ref: Nature, 409:685, 2001 : PubMed

            

    Title: High-efficiency full-length cDNA cloning
    Carninci P, Hayashizaki Y
    Ref: Methods Enzymol, 303:19, 1999 : PubMed

            

    Title: Pancreatic lipase-related protein 1 mRNA in female mouse lacrimal gland
    Remington SG, Lima PH, Nelson JD
    Ref: Invest Ophthalmol Vis Sci, 40:1081, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer