Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-ABHD6

Mus musculus (Mouse) Monoacylglycerol lipase ABHD6

Comment
Monoacylglycerol lipase ABHD6 hydrolyses the endocannabinoid 2-arachidonoylglycerol (2-AG). 2-AG regulates neurotransmission and neuroinflammation by activating CB1 cannabinoid receptors on neurons and CB2 cannabinoid receptors on microglia. (A MGLL human-MGLL or MAGLL is the other enzympe hydrolyzing 26AG.(belong to Monoglyceridelipase_lysophospholip family) ABHD6 of animals is homologous to some bacterial enzymes. For bacterial enzymes, this family correspond to family V.1 of the classification of Arpigny and Jaeger 1999. Alpha/beta-Hydrolase domain 6 deletion induces adipose browning and prevents obesity and type 2 diabetes and is published by Zhao et al.


Relationship
Family|ABHD6-Lip
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Bis(monoacylglycerol)phosphate
No inhibitor
3 Genbank : AK002883, AK168782, AK018260
2 UniProt : Q8R2Y0, Q9D375
2 UniProt : Q8R2Y0, Q9D375
2 Interpro : Q8R2Y0, Q9D375
2 Pfam : Q8R2Y0, Q9D375
2 PIRSF : Q8R2Y0, Q9D375
2 SUPERFAM : Q8R2Y0, Q9D375
1 MGD : 1913332
1 ENSEMBL : ENSMUSG00000025277
Sequence
Graphical view for this peptide sequence: mouse-ABHD6
Colored MSA for ABHD6-Lip (raw)
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQV
RYAHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKGMWLSVVKFLPKNLHL
VCVDMPGHEGTTRSSLDDLSIVGQVKRIHQFVECLKLNKKPFHLIGTSMG
GHVAGVYAAYYPSDVCSLSLVCAAGLQYSTDNPFVQRLKELEESAAIQKI
PLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNSFYRKLFLEI
VNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEV
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQV
RYAHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKGMWLSVVKFLPKNLHL
VCVDMPGHEGTTRSSLDDLSIVGQVKRIHQFVECLKLNKKPFHLIGTSMG
GHVAGVYAAYYPSDVCSLSLVCAAGLQYSTDNPFVQRLKELEESAAIQKI
PLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNSFYRKLFLEI
VNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEV
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLN


References
12 more
    Title: The serine hydrolase ABHD6 controls survival and thermally induced seizures in a mouse model of Dravet syndrome
    Westenbroek R, Kaplan J, Viray K, Stella N
    Ref: Neurobiol Dis, 180:106099, 2023 : PubMed

            

    Title: Termination of acute stress response by the endocannabinoid system is regulated through LSD1-mediated transcriptional repression of 2-AG hydrolases ABHD6 and MAGL
    Longaretti A, Forastieri C, Gabaglio M, Rubino T, Battaglioli E, Rusconi F
    Ref: Journal of Neurochemistry, :e15000, 2020 : PubMed

            

    Title: Functional annotation of a full-length mouse cDNA collection
    Kawai J, Shinagawa A, Shibata K, Yoshino M, Itoh M, Ishii Y, Arakawa T, Hara A, Fukunishi Y and Hayashizaki Y <86 more author(s)>
    Ref: Nature, 409:685, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer