Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-ACHE

Mus musculus (Mouse) acetylcholinesterase

Comment
Alternate Cterminus: T or H peptide


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
67 mutations: Table (e.g. : A262C, B5-174-A175-487-B488-575_mouse-chimerae-ACHE-BCHE, B5-174-A175-575_mouse-chimerae-ACHE-BCHE ... more)
94 structures (e.g. : 1J06, 1J07, 1KU6... more)
Kinetic: mouse-ACHE





2 substrates: Acetylcholine, Acetylthiocholine
39 inhibitors (e.g. : 4-methyl-3-nitrobenzamido-pentyl-1a, AMTS13, C-547... more)
>3 Genbank links 7 more: ACF22905, X56518, XP_282614
3 UniProt : P21836, B9UIT4, A0A0G2JDM6
1 Ncbi-nid : 49844
1 Ncbi-pid : 49845
>3 Structure links 91 more: 1MAH, 1MAA, 7QYN
>3 UniProt links 1 more: P21836, Q543Z1, B9UIT4
>3 Interpro links 1 more: P21836, Q543Z1, B9UIT4
>3 Prodom links 1 more: P21836, Q543Z1, B9UIT4
>3 Pfam links 1 more: P21836, Q543Z1, B9UIT4
>3 PIRSF links 1 more: P21836, Q543Z1, B9UIT4
>3 SUPERFAM links 1 more: P21836, Q543Z1, B9UIT4
1 MGD : 87876
2 ENSEMBL : P21836, ENSMUSG00000023328
Sequence
Graphical view for this peptide sequence: mouse-ACHE
Colored MSA for ACHE (raw)
MRPPWYPLHTPSLAFPLLFLLLSLLGGGARAEGREDPQLLVRVRGGQLRG
IRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVC
YQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIY
GGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPG
NVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSR
SLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTEL
IACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTG
DFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQ
ASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLA
AQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEE
RIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLE
VRRGLRAQTCAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQERCSDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRPPWYPLHTPSLAFPLLFLLLSLLGGGARAEGREDPQLLVRVRGGQLRG
IRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVC
YQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIY
GGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPG
NVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSR
SLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTEL
IACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTG
DFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQ
ASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLA
AQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEE
RIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLE
VRRGLRAQTCAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQERCSDL


References
30 more
    Title: Dual Reversible Coumarin Inhibitors Mutually Bound to Monoamine Oxidase B and Acetylcholinesterase Crystal Structures
    Ekstrom F, Gottinger A, Forsgren N, Catto M, Iacovino LG, Pisani P, Binda C
    Ref: ACS Med Chem Lett, 13:499, 2022 : PubMed

            

    Title: An Unusual Dimeric Inhibitor of Acetylcholinesterase: Cooperative Binding of Crystal Violet
    Allgardsson A, David Andersson C, Akfur C, Worek F, Linusson A, Ekstrom F
    Ref: Molecules, 22:, 2017 : PubMed

            

    Title: The Nature of Activated Non-classical Hydrogen Bonds: A Case Study on Acetylcholinesterase-Ligand Complexes
    Berg L, Mishra BK, Andersson CD, Ekstrom F, Linusson A
    Ref: Chemistry, 22:2672, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer