mouse-Abhd11

 
Mus musculus (Mouse) Abhydrolase domain-containing protein 11 Williams-Beuren syndrome chromosomal region 21 protein

Relationship
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic


Inhibitor: ABP-C6 , NBD-TG , NBD-HE-HP ,
>3 Genbank links 6 more: AF412033, AK004244, BC069865
3 UniProt : Q8K4F5, D3YYK0, A0A0J9YU40
3 UniProtTrembl : Q8K4F5, D3YYK0, A0A0J9YU40
3 Interpro : Q8K4F5, D3YYK0, A0A0J9YU40
3 Prodom : Q8K4F5, D3YYK0, A0A0J9YU40
3 Pfam : Q8K4F5, D3YYK0, A0A0J9YU40
3 PIRSF : Q8K4F5, D3YYK0, A0A0J9YU40
3 SUPERFAM : Q8K4F5, D3YYK0, A0A0J9YU40
3 QuickSwissBlast : Q8K4F5, D3YYK0, A0A0J9YU40
1 MGD : 1916008
1 ENSEMBL : ENSMUSG00000040532
 
Sequence
Graphical view for this peptide sequence: mouse-Abhd11
Colored MSA for ABHD11-Acetyl_transferase (raw)
MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYN
LLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDS
PHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVV
ERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSS
VVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSG
PTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMD
AVTSFLA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYN
LLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDS
PHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVV
ERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSS
VVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSG
PTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMD
AVTSFLA

no DNA




References
    Title: Identification of additional transcripts in the Williams-Beuren syndrome critical region
    Merla G, Ucla C, Guipponi M, Reymond A
    Ref: Hum Genet, 110:429, 2002 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer