Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-Abhd16a

Mus musculus (Mouse) Phosphatidylserine lipase ABHD16A, bat5 (hla-b-associated transcript 5) (ng26 protein)

Relationship
Family|ABHD16
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
1 inhbitor:
KC01
>3 Genbank links 2 more: AAC84159, BC029114, AAH29114
1 UniProt : Q9Z1Q2
2 UniProt : Q9Z1Q2, G3UX11
2 Interpro : Q9Z1Q2, G3UX11
2 Prodom : Q9Z1Q2, G3UX11
2 Pfam : Q9Z1Q2, G3UX11
2 PIRSF : Q9Z1Q2, G3UX11
2 SUPERFAM : Q9Z1Q2, G3UX11
1 MGD : 99476
1 ENSEMBL : ENSMUSG00000007036
Sequence
Graphical view for this peptide sequence: mouse-Abhd16a
Colored MSA for ABHD16 (raw)
MAKLLSCVLGPRLYKIYRERDTDRAASSVPETPTAVPAASSSSWDTYYQP
RALEKHADSILALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYA
GTLLLLLAGVACLRGIGRWTNPQYRQFITILEATHRNQSAENKRQLANYN
FDFRSWPVDFHWEEPSSRKGSRGGPSRRGVALLRPEPLHRGTADTFLNRV
KKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNG
RRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTP
LEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIV
IYAWSIGGFTATWAAMSYPDISAVILDASFDDLVPLALKVMPDSWRALVT
RTVRQHLNLNNSEQLCRFQGPVLLVRRTKDEIITTTVPEDIMSNRGNDLL
LKLLQFRYPRVMVEEGLRAVRQWLEASSQLEEASIYSRWEVEEDWCVSVL
RSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFEATHCTPLPAQ
HFQMPWHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAKLLSCVLGPRLYKIYRERDTDRAASSVPETPTAVPAASSSSWDTYYQP
RALEKHADSILALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYA
GTLLLLLAGVACLRGIGRWTNPQYRQFITILEATHRNQSAENKRQLANYN
FDFRSWPVDFHWEEPSSRKGSRGGPSRRGVALLRPEPLHRGTADTFLNRV
KKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNG
RRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTP
LEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIV
IYAWSIGGFTATWAAMSYPDISAVILDASFDDLVPLALKVMPDSWRALVT
RTVRQHLNLNNSEQLCRFQGPVLLVRRTKDEIITTTVPEDIMSNRGNDLL
LKLLQFRYPRVMVEEGLRAVRQWLEASSQLEEASIYSRWEVEEDWCVSVL
RSYQAEHGPDFPWSVGEDMSADGRRQLALFLARKHLHNFEATHCTPLPAQ
HFQMPWHL


References
    Title: Immunomodulatory lysophosphatidylserines are regulated by ABHD16A and ABHD12 interplay
    Kamat SS, Camara K, Parsons WH, Chen DH, Dix MM, Bird TD, Howell AR, Cravatt BF
    Ref: Nat Chemical Biology, 11:164, 2015 : PubMed

            

    Title: Biochemical and Pharmacological Characterization of the Human Lymphocyte Antigen B-Associated Transcript 5 (BAT5/ABHD16A)
    Savinainen JR, Patel JZ, Parkkari T, Navia-Paldanius D, Marjamaa JJ, Laitinen T, Nevalainen T, Laitinen JT
    Ref: PLoS ONE, 9:e109869, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer