mouse-Abhd8

 
Mus musculus Q9JMF5-Abhd8 (Mouse) epoxide hydrolase (EC 3.3.2.3)

Comment
1aa diff Q8R0P8 Strausberg R et al/ Q9DC79


Relationship
Family ABHD8
Block X
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



>3 Genbank links 4 more: AK003090, AK037669, NM_022419
1 Ncbi-nid : 12833529
1 Ncbi-pid : 12833530
3 UniProtTrembl : Q8R0P8, Q9DC79, Q9JMF5
3 Interpro : Q8R0P8, Q9DC79, Q9JMF5
3 Prodom : Q8R0P8, Q9DC79, Q9JMF5
3 Pfam : Q8R0P8, Q9DC79, Q9JMF5
3 PIRSF : Q8R0P8, Q9DC79, Q9JMF5
3 SUPERFAM : Q8R0P8, Q9DC79, Q9JMF5
3 QuickSwissBlast : Q8R0P8, Q9DC79, Q9JMF5
1 MGD : 1918946
1 ENSEMBL : ENSMUSG00000007950
 
Sequence
Graphical view for this peptide sequence: mouse-Abhd8
Colored MSA for ABHD8 (raw)
MTSEHTMLTGVTDGFFCCLLGTPPNAVRPLESVESSDGYTFVEVKPGRVL
RVKHAGPAPIPTPPPPPPEDDPGVKTGLVRCQRPITVYRNGRLVVENLGR
APRADLQGRSGSGDPPAALEVELAEPAGGDTRANPGSGRRRRPRRPKRTI
HIDCEQRITSCKGAQADVVLFFIHGVGGSLAIWKEQLDFFVRLGYEVVAP
DLAGHGASSAPQVAAAYTFYALAEDMRAIFTRYAKKRNVLIGHSYGVSFC
TFLAHEYPDLVHKVIMINGGGPTALEPSLCSIFNMPTCVLHCLSPCLAWS
FLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAEL
TVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIEEGSHMVMLECPETV
NTLLHEFLLWEPEPEAEPKLEPKPKPQLLQPEPAPGEEK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSEHTMLTGVTDGFFCCLLGTPPNAVRPLESVESSDGYTFVEVKPGRVL
RVKHAGPAPIPTPPPPPPEDDPGVKTGLVRCQRPITVYRNGRLVVENLGR
APRADLQGRSGSGDPPAALEVELAEPAGGDTRANPGSGRRRRPRRPKRTI
HIDCEQRITSCKGAQADVVLFFIHGVGGSLAIWKEQLDFFVRLGYEVVAP
DLAGHGASSAPQVAAAYTFYALAEDMRAIFTRYAKKRNVLIGHSYGVSFC
TFLAHEYPDLVHKVIMINGGGPTALEPSLCSIFNMPTCVLHCLSPCLAWS
FLKAGFARQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAEL
TVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIEEGSHMVMLECPETV
NTLLHEFLLWEPEPEAEPKLEPKPKPQLLQPEPAPGEEK

Graphical view for this nucleotide DNA sequence (2018 bp): mouse-Abhd8



References
3 more
    Title: Normalization and subtraction of cap-trapper-selected cDNAs to prepare full-length cDNA libraries for rapid discovery of new genes
    Carninci P, Shibata Y, Hayatsu N, Sugahara Y, Shibata K, Itoh M, Konno H, Okazaki Y, Muramatsu M, Hayashizaki Y
    Ref: Genome Res, 10:1617, 2000 : PubMed

            

    Title: Growth suppression of Escherichia coli by induction of expression of mammalian genes with transmembrane or ATPase domains
    Inoue S, Sano H, Ohta M
    Ref: Biochemical & Biophysical Research Communications, 268:553, 2000 : PubMed

            

    Title: High-efficiency full-length cDNA cloning
    Carninci P, Hayashizaki Y
    Ref: Methods Enzymol, 303:19, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer