Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-BCHE

Mus musculus mRNA for butyrylcholinesterase

Comment
Cterminus T peptide


Relationship
Family|BCHE
Block| C
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
6 mutations: Table (e.g. : A199S/S227A/S287G/A328W/Y332G, B5-174-A175-487-B488-575_mouse-chimerae-ACHE-BCHE, B5-174-A175-575_mouse-chimerae-ACHE-BCHE ... more)
No structure
Kinetic: mouse-BCHE





3 substrates: Acetylcholine, Acetylthiocholine, Butyrylthiocholine
1 inhbitor:
ABP-C6
>3 Genbank links 2 more: EDL15482, M99492, NM_009738
2 UniProt : Q03311, A0A0A6YVZ5
1 Ncbi-nid : 191579
3 UniProt : Q03311, Q499C7, A0A0A6YVZ5
3 Interpro : Q03311, Q499C7, A0A0A6YVZ5
3 Prodom : Q03311, Q499C7, A0A0A6YVZ5
3 Pfam : Q03311, Q499C7, A0A0A6YVZ5
3 PIRSF : Q03311, Q499C7, A0A0A6YVZ5
3 SUPERFAM : Q03311, Q499C7, A0A0A6YVZ5
1 MGD : 894278
2 ENSEMBL : Q03311, ENSMUSG00000027792
Sequence
Graphical view for this peptide sequence: mouse-BCHE
Colored MSA for BCHE (raw)
MQTQHTKVTQTHFLLWILLLCMPFGKSHTEEDFIITTKTGRVRGLSMPVL
GGTVTAFLGIPYAQPPLGSLRFKKPQPLNKWPDIHNATQYANSCYQNIDQ
AFPGFQGSEMWNPNTNLSEDCLYLNVWIRVPKPKNATVMVWIYGGGFQTG
TSSLPVYDGKFLARVERVIVVSMNYRVGALGFLAFPGNPDAPGNMGLFDQ
QLALQWVQRNIAAFGGNPKSITIFGESAGAASVSLHLLCPQSYPLFTRAI
LESGSSNAPWAVKHPEEARNRTLTLAKFTGCSKENEMEMIKCLRSKDPQE
ILRNERFVLPSDSILSINFGPTVDGDFLTDMPHTLLQLGKVKKAQILVGV
NKDEGTAFLVYGAPGFSKDNDSLITRKEFQEGLNMYFPGVSRLGKEAVLF
YYVDWLGEQSPEVYRDALDDVIGDYNIICPALEFTKKFAELENNAFFYFF
EHRSSKLPWPEWMGVMHGYEIEFVFGLPLGRRVNYTRAEEIFSRSIMKTW
ANFAKYGHPNGTQGNSTMWPVFTSTEQKYLTLNTEKSKIYSKLRAPQCQF
WRLFFPKVLEMTGDIDETEQEWKAGFHRWSNYMMDWQNQFNDYTSKKESC
TAL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQTQHTKVTQTHFLLWILLLCMPFGKSHTEEDFIITTKTGRVRGLSMPVL
GGTVTAFLGIPYAQPPLGSLRFKKPQPLNKWPDIHNATQYANSCYQNIDQ
AFPGFQGSEMWNPNTNLSEDCLYLNVWIRVPKPKNATVMVWIYGGGFQTG
TSSLPVYDGKFLARVERVIVVSMNYRVGALGFLAFPGNPDAPGNMGLFDQ
QLALQWVQRNIAAFGGNPKSITIFGESAGAASVSLHLLCPQSYPLFTRAI
LESGSSNAPWAVKHPEEARNRTLTLAKFTGCSKENEMEMIKCLRSKDPQE
ILRNERFVLPSDSILSINFGPTVDGDFLTDMPHTLLQLGKVKKAQILVGV
NKDEGTAFLVYGAPGFSKDNDSLITRKEFQEGLNMYFPGVSRLGKEAVLF
YYVDWLGEQSPEVYRDALDDVIGDYNIICPALEFTKKFAELENNAFFYFF
EHRSSKLPWPEWMGVMHGYEIEFVFGLPLGRRVNYTRAEEIFSRSIMKTW
ANFAKYGHPNGTQGNSTMWPVFTSTEQKYLTLNTEKSKIYSKLRAPQCQF
WRLFFPKVLEMTGDIDETEQEWKAGFHRWSNYMMDWQNQFNDYTSKKESC
TAL


Reference
    Title: Molecular cloning of mouse acetylcholinesterase: tissue distribution of alternatively spliced mRNA species
    Rachinsky TL, Camp S, Li Y, Ekstrom TJ, Newton M, Taylor P
    Ref: Neuron, 5:317, 1990 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer