Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-Ces1f

Mus musculus (Mouse) carboxylesterase ML1, CESmML1 61.6 kda protein ES-4 (EC 3.1.1.1)

Comment
Liver carboxylesterase 4 precursor (Carboxylesterase ES-4) Microsomal Palmitoyl-CoA Hydrolase) (Kidney microsomal carboxylesterase)


Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
2 inhibitors: ABP-C6, NBD-HE-HP
>3 Genbank links 3 more: AB023632, AK136491, BC013479
1 UniProt : Q3UWB1
1 Ncbi-nid : 20885914
1 Ncbi-pid : 20885915
3 UniProt : Q924V7, Q91WU0, Q3UWB1
3 Interpro : Q924V7, Q91WU0, Q3UWB1
3 Prodom : Q924V7, Q91WU0, Q3UWB1
3 Pfam : Q924V7, Q91WU0, Q3UWB1
3 PIRSF : Q924V7, Q91WU0, Q3UWB1
3 SUPERFAM : Q924V7, Q91WU0, Q3UWB1
1 MGD : 2142687
1 ENSEMBL : ENSMUSG00000031725
Sequence
Graphical view for this peptide sequence: mouse-Ces1f
Colored MSA for Carb_B_Chordata (raw)
MFLSTLFLVSLATCVICGNPSSPPVVDTAHGKVLGKHVNVEGFSQPVAVF
LGIPFAKPPLGSLRFAPPQPAEPWSSVKNATTYPPMCSQDAARGQAVNDL
ITNRKEKIHLEFSEDCLYLNIYTPADFSKNSRLPVMVWIHGGGLKLGGAS
SFDGRALSAYENVVVVAIQYRLSIWGFFSTGDEHSRGNWGHLDQVAALHW
VQDNIANFGGDPGSVTIFGESAGGYSVSILILSPLSKNLFHRAISESGVA
FIPGMFTKDVRPITEQIAVTAGCKTTTSAVIVHCMRQKTEEELLEIMHKL
NLYKLSLQGDTKNSDQFVTSVLDGVVLPKDPKEILAEKNFNTVPYIVGIN
KQECGWLLPTMTGFLPADVKLDKKKAIALLEQFASMTGIPEDIIPVAVEK
YTKGSDDPDQIREGVLDAMGDVAFGVPSVIVSRGHRDTGAPTYMYEYQYY
PSFSSPQRPKNVVGDHADDVYSVFGAPILREGASEEEINLSKMVMKFWAN
FARNGNPNGKGLPHWPKYDQKEGYLHIGGTTQQAQRLKEEEVTFWTQSLA
KKQPQPYHNEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFLSTLFLVSLATCVICGNPSSPPVVDTAHGKVLGKHVNVEGFSQPVAVF
LGIPFAKPPLGSLRFAPPQPAEPWSSVKNATTYPPMCSQDAARGQAVNDL
ITNRKEKIHLEFSEDCLYLNIYTPADFSKNSRLPVMVWIHGGGLKLGGAS
SFDGRALSAYENVVVVAIQYRLSIWGFFSTGDEHSRGNWGHLDQVAALHW
VQDNIANFGGDPGSVTIFGESAGGYSVSILILSPLSKNLFHRAISESGVA
FIPGMFTKDVRPITEQIAVTAGCKTTTSAVIVHCMRQKTEEELLEIMHKL
NLYKLSLQGDTKNSDQFVTSVLDGVVLPKDPKEILAEKNFNTVPYIVGIN
KQECGWLLPTMTGFLPADVKLDKKKAIALLEQFASMTGIPEDIIPVAVEK
YTKGSDDPDQIREGVLDAMGDVAFGVPSVIVSRGHRDTGAPTYMYEYQYY
PSFSSPQRPKNVVGDHADDVYSVFGAPILREGASEEEINLSKMVMKFWAN
FARNGNPNGKGLPHWPKYDQKEGYLHIGGTTQQAQRLKEEEVTFWTQSLA
KKQPQPYHNEL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer