Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-Ces2c

Mus musculus (Mouse) Ces2c similar to carboxylesterase 2 (intestine, liver) Acylcarnitine hydrolase

Comment
Hydrolase with high activity towards palmitoylcarnitine. Is also active with p-nitrophenylacetate and alpha-naphthylacetate. Furihata et al.


Relationship
Family|Carb_B_Chordata
Block| C
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
8AXC: Crystal Structure of Mouse Ces2c
No kinetic





8 substrates (e.g. : 1,2-Diolein, 2-Arachidonylglycerol, Molnupiravir... more)
1 inhbitor:
ABP-C6
3 Genbank : BC015290, AC166833, BAC76623
1 UniProt : Q91WG0
1 Ncbi-nid : 15929733
1 Ncbi-pid : 15929734
1 Structure : 8AXC
2 UniProt : Q91WG0, Q8K033
2 Interpro : Q91WG0, Q8K033
2 Prodom : Q91WG0, Q8K033
2 Pfam : Q91WG0, Q8K033
2 PIRSF : Q91WG0, Q8K033
2 SUPERFAM : Q91WG0, Q8K033
1 MGD : 2385905
1 ENSEMBL : ENSMUSG00000061825
Sequence
Graphical view for this peptide sequence: mouse-Ces2c
Colored MSA for Carb_B_Chordata (raw)
MTRNQLHNWLNAGFFGLLLLLIHVQGQDSPEANPIRNTHTGQIQGSLIHV
KDTKAGVHTFLGIPFAKPPVGPLRFAPPEAPEPWSGVRDGTAHPAMCLQN
LDMLNEAGLPDMKMMLSSFPMSEDCLYLNIYTPAHAHEGSNLPVMVWIHG
GALVIGMASMFDGSLLTVNEDLVVVTIQYRLGVLGFFSTGDQHARGNWGY
LDQAAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSSHVVSPMSQGLFH
GAIMESGVALLPDLISETSEMVSTTVAKLSGCEAMDSQALVRCLRGKSEA
EILAINKVFKMIPAVVDGEFFPRHPKELLASEDFHPVPSIIGVNNDEFGW
SIPVVMGSAQMIKGITRENLQAVLKDTAVQMMLPPECSDLLMEEYMGDTE
DAQTLQIQFTEMMGDFMFVIPALQVAHFQRSHAPVYFYEFQHPPSYFKDV
RPPHVKADHADEIPFVFASFFWGMKLDFTEEEELLSRRMMKYWANFARHG
NPNSEGLPYWPVMDHDEQYLQLDIQPAVGRALKAGRLQFWTKTLPQKIQE
LKASQDKHREL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTRNQLHNWLNAGFFGLLLLLIHVQGQDSPEANPIRNTHTGQIQGSLIHV
KDTKAGVHTFLGIPFAKPPVGPLRFAPPEAPEPWSGVRDGTAHPAMCLQN
LDMLNEAGLPDMKMMLSSFPMSEDCLYLNIYTPAHAHEGSNLPVMVWIHG
GALVIGMASMFDGSLLTVNEDLVVVTIQYRLGVLGFFSTGDQHARGNWGY
LDQAAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSSHVVSPMSQGLFH
GAIMESGVALLPDLISETSEMVSTTVAKLSGCEAMDSQALVRCLRGKSEA
EILAINKVFKMIPAVVDGEFFPRHPKELLASEDFHPVPSIIGVNNDEFGW
SIPVVMGSAQMIKGITRENLQAVLKDTAVQMMLPPECSDLLMEEYMGDTE
DAQTLQIQFTEMMGDFMFVIPALQVAHFQRSHAPVYFYEFQHPPSYFKDV
RPPHVKADHADEIPFVFASFFWGMKLDFTEEEELLSRRMMKYWANFARHG
NPNSEGLPYWPVMDHDEQYLQLDIQPAVGRALKAGRLQFWTKTLPQKIQE
LKASQDKHREL


References
3 more
    Title: The Crystal Structure of Mouse Ces2c, a Potential Ortholog of Human CES2, Shows Structural Similarities in Substrate Regulation and Product Release to Human CES1
    Eisner H, Riegler-Berket L, Gamez CFR, Sagmeister T, Chalhoub G, Darnhofer B, Jazleena PJ, Birner-Gruenberger R, Pavkov-Keller T and Oberer M <2 more author(s)>
    Ref: Int J Mol Sci, 23:, 2022 : PubMed

            

    Title: Lineage-specific biology revealed by a finished genome assembly of the mouse
    Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL and Ponting CP <21 more author(s)>
    Ref: PLoS Biol, 7:e1000112, 2009 : PubMed

            

    Title: Purification, molecular cloning, and functional expression of inducible liver acylcarnitine hydrolase in C57BL/6 mouse, belonging to the carboxylesterase multigene family
    Furihata T, Hosokawa M, Nakata F, Satoh T, Chiba K
    Ref: Archives of Biochemistry & Biophysics, 416:101, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer