mouse-DGLB

 
Mus musculus (Mouse) Daglb Sn1-specific diacylglycerol lipase beta 64.9 kda protein

Comment
Q91WC9 Strausberg R. and Q8BU39 differ by the 89 first amino acid (alternative splicing?) Q8BU97 by 29 aa. Q8BU97 and Q8BU39 are from Okazaki et al.similar N -term as human sequence


Relationship
Family Lipase_3
Block L
Mus musculus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : BC016105, NM_144915
1 UniProt : Q91WC9
1 UniProtTrembl : Q91WC9
1 Interpro : Q91WC9
1 Prodom : Q91WC9
1 Pfam : Q91WC9
1 PIRSF : Q91WC9
1 SUPERFAM : Q91WC9
1 QuickSwissBlast : Q91WC9
1 ENSEMBL : ENSMUSG00000039206
 
Sequence
Graphical view for this peptide sequence: mouse-DGLB
Colored MSA for Lipase_3 (raw)
MRGTICNPGPRKSMSKLLYIRLALFLPEMVWASLGAAWVAKGIQCDRTVV
IGIIATVIVSWIVIAATMVTIIFVFDPLGGKMAPYPPCIPEHLDSNSSNR
LLTGLKTAAKSVWETRVQFCCCCVGQDDNTRVAFSSTADLFSTYFSDTDL
VPSDIAAGFTLLHQQQDNISHSREPPEVVTHTPGQPQETELDAEVENCHH
YMPFAAAAYGWPLYIYRNPFTGLCRIGGDCCRARDIEYDAVEGDQHNCHF
ASILKTTGLQYRDFIHISFHDKVYELPFIVVLDHRKESVVVAVRGTMSLQ
DVLTDLSAESETLELGIELQDCVAHKGIAQAARYIHRRLVNDGILSQAFS
VAPEYQLVLVGHSLGAGAAALLAIMLRGAYPQVRAYAFSPPRGLLSKSLY
EYSKDFVVSLILGMDVIPRLSVTNMEDLKRRILRVIANCNKPKYKILLHG
CWYGLFGGSPDNFPTELDEGTQGALTQPLLGEQTLLTRYSPGYCSSDSPL
DSPTKYPTLYPPGRIIHLEEEGGSGRFGCCSAAQYRARWAHEAEFSKILI
GPKMLIDHMPDVMIRALDRVLADRTACVSCPGQGGSSVP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRGTICNPGPRKSMSKLLYIRLALFLPEMVWASLGAAWVAKGIQCDRTVV
IGIIATVIVSWIVIAATMVTIIFVFDPLGGKMAPYPPCIPEHLDSNSSNR
LLTGLKTAAKSVWETRVQFCCCCVGQDDNTRVAFSSTADLFSTYFSDTDL
VPSDIAAGFTLLHQQQDNISHSREPPEVVTHTPGQPQETELDAEVENCHH
YMPFAAAAYGWPLYIYRNPFTGLCRIGGDCCRARDIEYDAVEGDQHNCHF
ASILKTTGLQYRDFIHISFHDKVYELPFIVVLDHRKESVVVAVRGTMSLQ
DVLTDLSAESETLELGIELQDCVAHKGIAQAARYIHRRLVNDGILSQAFS
VAPEYQLVLVGHSLGAGAAALLAIMLRGAYPQVRAYAFSPPRGLLSKSLY
EYSKDFVVSLILGMDVIPRLSVTNMEDLKRRILRVIANCNKPKYKILLHG
CWYGLFGGSPDNFPTELDEGTQGALTQPLLGEQTLLTRYSPGYCSSDSPL
DSPTKYPTLYPPGRIIHLEEEGGSGRFGCCSAAQYRARWAHEAEFSKILI
GPKMLIDHMPDVMIRALDRVLADRTACVSCPGQGGSSVP

no DNA




References
3 more
    Title: Deficiency in endocannabinoid synthase DAGLB contributes to early onset Parkinsonism and murine nigral dopaminergic neuron dysfunction
    Liu Z, Yang N, Dong J, Tian W, Chang L, Ma J, Guo J, Tan J, Dong A and Tang B <27 more author(s)>
    Ref: Nat Commun, 13:3490, 2022 : PubMed

            

    Title: In situ localization of diacylglycerol lipase alpha and beta producing an endocannabinoid 2-arachidonoylglycerol and of cannabinoid receptor 1 in the primary oocytes of postnatal mice
    Kamnate A, Sirisin J, Polsan Y, Chomphoo S, Watanabe M, Kondo H, Hipkaeo W
    Ref: Journal of Anatomy, :, 2021 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer