Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-DGLB

Mus musculus (Mouse) Daglb Sn1-specific diacylglycerol lipase beta 64.9 kda protein

Comment
Q91WC9 Strausberg R. and Q8BU39 differ by the 89 first amino acid (alternative splicing?) Q8BU97 by 29 aa. Q8BU97 and Q8BU39 are from Okazaki et al.similar N -term as human sequence


Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : BC016105, NM_144915
1 UniProt : Q91WC9
1 UniProt : Q91WC9
1 Interpro : Q91WC9
1 Prodom : Q91WC9
1 Pfam : Q91WC9
1 PIRSF : Q91WC9
1 SUPERFAM : Q91WC9
1 ENSEMBL : ENSMUSG00000039206
Sequence
Graphical view for this peptide sequence: mouse-DGLB
Colored MSA for Lipase_3 (raw)
MRGTICNPGPRKSMSKLLYIRLALFLPEMVWASLGAAWVAKGIQCDRTVV
IGIIATVIVSWIVIAATMVTIIFVFDPLGGKMAPYPPCIPEHLDSNSSNR
LLTGLKTAAKSVWETRVQFCCCCVGQDDNTRVAFSSTADLFSTYFSDTDL
VPSDIAAGFTLLHQQQDNISHSREPPEVVTHTPGQPQETELDAEVENCHH
YMPFAAAAYGWPLYIYRNPFTGLCRIGGDCCRARDIEYDAVEGDQHNCHF
ASILKTTGLQYRDFIHISFHDKVYELPFIVVLDHRKESVVVAVRGTMSLQ
DVLTDLSAESETLELGIELQDCVAHKGIAQAARYIHRRLVNDGILSQAFS
VAPEYQLVLVGHSLGAGAAALLAIMLRGAYPQVRAYAFSPPRGLLSKSLY
EYSKDFVVSLILGMDVIPRLSVTNMEDLKRRILRVIANCNKPKYKILLHG
CWYGLFGGSPDNFPTELDEGTQGALTQPLLGEQTLLTRYSPGYCSSDSPL
DSPTKYPTLYPPGRIIHLEEEGGSGRFGCCSAAQYRARWAHEAEFSKILI
GPKMLIDHMPDVMIRALDRVLADRTACVSCPGQGGSSVP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRGTICNPGPRKSMSKLLYIRLALFLPEMVWASLGAAWVAKGIQCDRTVV
IGIIATVIVSWIVIAATMVTIIFVFDPLGGKMAPYPPCIPEHLDSNSSNR
LLTGLKTAAKSVWETRVQFCCCCVGQDDNTRVAFSSTADLFSTYFSDTDL
VPSDIAAGFTLLHQQQDNISHSREPPEVVTHTPGQPQETELDAEVENCHH
YMPFAAAAYGWPLYIYRNPFTGLCRIGGDCCRARDIEYDAVEGDQHNCHF
ASILKTTGLQYRDFIHISFHDKVYELPFIVVLDHRKESVVVAVRGTMSLQ
DVLTDLSAESETLELGIELQDCVAHKGIAQAARYIHRRLVNDGILSQAFS
VAPEYQLVLVGHSLGAGAAALLAIMLRGAYPQVRAYAFSPPRGLLSKSLY
EYSKDFVVSLILGMDVIPRLSVTNMEDLKRRILRVIANCNKPKYKILLHG
CWYGLFGGSPDNFPTELDEGTQGALTQPLLGEQTLLTRYSPGYCSSDSPL
DSPTKYPTLYPPGRIIHLEEEGGSGRFGCCSAAQYRARWAHEAEFSKILI
GPKMLIDHMPDVMIRALDRVLADRTACVSCPGQGGSSVP


References
4 more
    Title: Deficiency in endocannabinoid synthase DAGLB contributes to early onset Parkinsonism and murine nigral dopaminergic neuron dysfunction
    Liu Z, Yang N, Dong J, Tian W, Chang L, Ma J, Guo J, Tan J, Dong A and Tang B <27 more author(s)>
    Ref: Nat Commun, 13:3490, 2022 : PubMed

            

    Title: In situ localization of diacylglycerol lipase alpha and beta producing an endocannabinoid 2-arachidonoylglycerol and of cannabinoid receptor 1 in the primary oocytes of postnatal mice
    Kamnate A, Sirisin J, Polsan Y, Chomphoo S, Watanabe M, Kondo H, Hipkaeo W
    Ref: Journal of Anatomy, :, 2021 : PubMed

            

    Title: Diacylglycerol Lipase-beta Knockout Mice Display a Sex-Dependent Attenuation of Traumatic Brain Injury-Induced Mortality with No Impact on Memory or Other Functional Consequences
    O'Brien LD, Smith TL, Donvito G, Cravatt BF, Newton J, Spiegel S, Reeves TM, Phillips LL, Lichtman AH
    Ref: Cannabis Cannabinoid Res, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer