Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-DPP6

Mus musculus (Mouse) dipeptidyl aminopeptidase-like protein 6 (fragment)

Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 11 more: AF092506, AF092507, BC048383
>3 UniProt links 1 more: Q9Z218, Q5U4C2, Q3TY19
>3 UniProt links 2 more: Q5U4C2, Q9Z218, Q80VM5
>3 Interpro links 2 more: Q5U4C2, Q9Z218, Q80VM5
>3 Prodom links 2 more: Q5U4C2, Q9Z218, Q80VM5
>3 Pfam links 2 more: Q5U4C2, Q9Z218, Q80VM5
>3 PIRSF links 2 more: Q5U4C2, Q9Z218, Q80VM5
>3 SUPERFAM links 2 more: Q5U4C2, Q9Z218, Q80VM5
1 MGD : 94921
2 ENSEMBL : Q9Z218, ENSMUSG00000061576
Sequence
Graphical view for this peptide sequence: mouse-DPP6
Colored MSA for DPP4N_Peptidase_S9 (raw)
MASLYQRFTGKINTSRSFPAPPEASRLLGGQGPEEDAGPEPLGPQAQAVA
PRERGGAGGRPRFQYQARSDCDEEDELVGSNPPQRNWKGIAIALLVILVI
CSLIVTSVILLTPAEDTSLSQKKKVTVEDLFSEDFKIHDPEAKWISNKEF
IYRERKGSVILRNVETNNSTVLIEGKKIESLRAIRYEISPDKEYVLFSYN
VEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIF
IFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKSHIAHWW
SPDGTRLAYATINDSRVPLMELPTYTGSVYPTVKPYHYPKAGSENPSISL
HVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVS
ILTLCDATTGVCTKKHEDESEAWLHRQNEEPVFSKDGRKFFFVRAIPQGG
RGKFYHITVSSSQPNSSNDNIQSITSGDWDVTKILSYDEKRNKIYFPSTE
DLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFSHNMDFFLLKCEG
PGVPTVTVHNTTDKRRMFDLEANEEVQKAINDRQMPKIEYRKIEVEDYSL
PMQILKPATFTDTAHYPLLLVVDGTPGSQSVTERFEVTWETVLVSSHGAV
VVKCDGRGSGFQGTTLLQEVRRRLGFLEEKDQMEAVRTMLKEQYIDKTRV
AVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERY
LGLHGLDNRAYEMTKLAHRVSALEDQQFLIIHATADEKIHFQHTAELITQ
LIKGKANYSLQIYPDESHYFHSVALKQHLSRSIIGFFVECFRVQDKLPTA
TAKEEEEED
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASLYQRFTGKINTSRSFPAPPEASRLLGGQGPEEDAGPEPLGPQAQAVA
PRERGGAGGRPRFQYQARSDCDEEDELVGSNPPQRNWKGIAIALLVILVI
CSLIVTSVILLTPAEDTSLSQKKKVTVEDLFSEDFKIHDPEAKWISNKEF
IYRERKGSVILRNVETNNSTVLIEGKKIESLRAIRYEISPDKEYVLFSYN
VEPVYQHSHTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIF
IFENNIYYCAHVGKQAIRVVSTGKEGVIYNGLSDWLYEEEILKSHIAHWW
SPDGTRLAYATINDSRVPLMELPTYTGSVYPTVKPYHYPKAGSENPSISL
HVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVS
ILTLCDATTGVCTKKHEDESEAWLHRQNEEPVFSKDGRKFFFVRAIPQGG
RGKFYHITVSSSQPNSSNDNIQSITSGDWDVTKILSYDEKRNKIYFPSTE
DLPRRRHLYSANTVDDFNRQCLSCDLVENCTYVSASFSHNMDFFLLKCEG
PGVPTVTVHNTTDKRRMFDLEANEEVQKAINDRQMPKIEYRKIEVEDYSL
PMQILKPATFTDTAHYPLLLVVDGTPGSQSVTERFEVTWETVLVSSHGAV
VVKCDGRGSGFQGTTLLQEVRRRLGFLEEKDQMEAVRTMLKEQYIDKTRV
AVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERY
LGLHGLDNRAYEMTKLAHRVSALEDQQFLIIHATADEKIHFQHTAELITQ
LIKGKANYSLQIYPDESHYFHSVALKQHLSRSIIGFFVECFRVQDKLPTA
TAKEEEEED


References
1 more
    Title: A novel structure associated with aging is augmented in the DPP6-KO mouse brain
    Lin L, Petralia RS, Lake R, Wang YX, Hoffman DA
    Ref: Acta Neuropathologica Commun, 8:197, 2020 : PubMed

            

    Title: Rump white inversion in the mouse disrupts dipeptidyl aminopeptidase-like protein 6 and causes dysregulation of Kit expression
    Hough RB, Lengeling A, Bedian V, Lo C, Bucan M
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 95:13800, 1998 : PubMed

            

    Title: Transcripts encoding a neural membrane CD26 peptidase-like protein are stimulated by synaptic activity
    de Lecea L, Soriano E, Criado JR, Steffensen SC, Henriksen SJ, Sutcliffe JG
    Ref: Brain Research Mol Brain Res, 25:286, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer